SecReT4
Protein ID: 56550576
T4SS name [ID]Trb [612]
Gene symbol-
Locus tagRMe0018
StrainCupriavidus metallidurans CH34 plasmid pMOL28 (NC_006525)
Repliconplasmid pMOL28 [GenBank: NC_006525] [Browse all T4SS(s) in this replicon]
Location [Strand]22573..23370 [+]
Producthypothetical protein
Component typeTrbN
UniProt IDQ5NV08
KEGG IDrme:Rmet_6298
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 265 a.a.     [Download]
>gi|56550576|ref|YP_161642.1| hypothetical protein RMe0018 [Cupriavidus metallidurans CH34]
MTKRLATLLIAVAASLGAQAATIEAVISPNAIVVKADGQARVHMLDGKPVLYCGLDAFLGWSARLLGAQI
EPGADDGPVVTLAGKATPIARLFTREGWLRPAVLNDAAQEALAERRGGWACAPKTEPFAQMGVRVDPKIT
AGIAMNESSYRGRPWPWTLNVSGRGMFFATREEAYAAVNRLLANDRCDFDVGLMQVNWCYHGKRFASPWE
ALAPATNIRVAEDILAENLQRSGSAMKAVAWYHSANPERGGPYFSRFMKHVAQFQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|56550557|ref|NC_006525.1|:22573-23370 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
GTGACTAAGCGGCTTGCGACGCTCCTGATTGCCGTTGCCGCATCGCTTGGCGCACAGGCTGCAACGATCG
AGGCCGTCATCAGCCCCAACGCTATCGTCGTCAAGGCAGACGGGCAGGCACGCGTCCATATGCTGGATGG
CAAGCCGGTCCTGTACTGCGGCCTTGACGCGTTCCTTGGCTGGTCCGCGCGGCTTCTCGGCGCGCAGATC
GAGCCGGGTGCCGACGACGGACCTGTCGTGACGTTGGCTGGCAAGGCGACGCCCATTGCCCGACTGTTCA
CGCGAGAAGGCTGGCTGCGACCGGCCGTGCTAAACGATGCGGCGCAAGAAGCCCTGGCCGAGCGACGCGG
CGGCTGGGCGTGCGCGCCGAAGACCGAGCCGTTTGCCCAGATGGGCGTTCGCGTCGATCCCAAGATCACA
GCCGGCATCGCCATGAACGAGTCGTCGTATCGCGGCCGTCCGTGGCCCTGGACGCTTAACGTGTCGGGTC
GCGGCATGTTCTTCGCCACGCGCGAGGAAGCGTACGCGGCCGTCAATCGTCTGCTCGCGAATGACCGTTG
CGACTTCGATGTGGGCTTGATGCAGGTGAATTGGTGCTACCACGGCAAGCGTTTTGCGTCGCCGTGGGAG
GCGCTTGCCCCAGCGACCAACATCCGCGTTGCCGAAGACATTCTGGCAGAGAACCTTCAGCGCAGCGGTT
CGGCCATGAAGGCTGTCGCCTGGTACCACAGCGCCAATCCCGAGCGCGGTGGGCCGTACTTTTCCCGCTT
CATGAAACACGTCGCCCAATTCCAATGA
 Primer design