SecReT4
Protein ID: 57238756
T4SS name [ID]VirB [497]
Gene symbolvirD4
Locus tagErum0260
StrainEhrlichia ruminantium str. Welgevonden
Repliconchromosome [GenBank: NC_005295] [Browse all T4SS(s) in this replicon]
Location [Strand]31165..33570 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ5HCF1
KEGG IDeru:Erum0260, erw:ERWE_CDS_00130
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.1e-153, Aligned region: 125..569
TraG-D_C [PF12696], Evalue: 6.2e-27, Aligned region: 408..530
TrwB_AAD_bind [PF10412], Evalue: 7.3e-26, Aligned region: 241..544
Protein Sequence: 801 a.a.     [Download]
>gi|57238756|ref|YP_179892.1| type IV secretion system component VirD4 [Ehrlichia ruminantium str. Welgevonden]
MDSTSANHIRNILFLFLGAFFGLEFCFYLSGVLFILMVWGPDYLDFNTINPSFHDFPDRIWPTIFTYIEH
WWHNPSLYDAVLLSKLAFSLIIPIGIFSAILWNLRNILFDWRPFKKKESLHGDSRWATEKDIRKIGLRSR
KGILLGKDKRGYLIADGFQHALLFAPTGSGKGVGFVIPNLLFWEDSVVVHDIKLENYELTSGWRKKRGQE
VFVWNPAQPDGISHCYNPLDWISSKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVK
SFGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTA
TASSDFNIQDFKRKKVTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRNLPSDDEPYGVLFLMDEFPTLGK
MEQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTV
NQESLNRPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDEQILLIESTYPIKSKKIKYFEDKNFTKKL
LKSTFVPTQEPYDPNNIKPTYKENENTIPSLEGNIPAKTDNQEHSMYESIEEEPDNYDDDFDFDDLDEYT
DEDYNQEFDDENYDQHDDIYDHKLDTYKENIDEDEDEDENEYEEDDESNEEDVYDDYQNEYHKNTDNTES
DTNEINMEYDHNIDQSEDQHHEQYNRNTDHINEGTDDYDDLDHQYEDEDNKESNEDEEENNNHISQNDYL
YENNDVEEDIKQTDNKKPKKKNTSKKKNAKQ
 
Nucleotide Sequence: 2406 bp     [Download]
>gi|57238731|ref|NC_005295.2|:c33570-31165 Ehrlichia ruminantium str. Welgevonden chromosome, complete genome
ATGGATAGTACAAGCGCAAATCATATTCGCAATATTTTATTTCTATTTCTAGGTGCATTCTTTGGACTAG
AATTTTGTTTCTATTTATCAGGTGTACTATTTATTCTAATGGTATGGGGACCAGATTATTTAGATTTTAA
CACAATAAATCCTAGTTTTCATGATTTTCCAGATAGAATTTGGCCTACAATTTTTACATATATAGAACAC
TGGTGGCACAATCCTTCACTATATGATGCAGTATTGTTATCAAAATTAGCATTTTCTTTAATAATACCAA
TAGGTATTTTCAGTGCTATATTATGGAACTTACGGAATATATTATTCGACTGGAGACCATTTAAGAAAAA
AGAATCTCTACATGGTGACTCAAGATGGGCAACAGAAAAAGATATACGTAAAATAGGTTTACGTAGTAGA
AAAGGTATACTATTAGGAAAAGATAAGAGAGGATACTTAATTGCTGACGGTTTTCAACATGCATTATTGT
TTGCACCAACAGGTTCTGGAAAAGGTGTAGGATTTGTAATACCCAACTTATTGTTTTGGGAAGATTCTGT
AGTAGTACATGACATAAAATTAGAGAACTATGAGTTAACAAGCGGATGGAGAAAGAAAAGAGGACAAGAA
GTTTTCGTATGGAATCCAGCACAACCAGATGGAATAAGTCATTGCTATAATCCTTTAGATTGGATAAGTT
CTAAACCTGGACAAATGGTAGATGATGTACAAAAAATTGCTAACTTAATAATGCCAGAACAAGATTTTTG
GTACAATGAAGCACGTAGTTTATTTGTTGGAGTAGTTTTATATCTACTTGCAGTACCAGAAAAAGTAAAA
TCTTTTGGAGAAGTTGTACGTACAATGCGTAGCGACGATGTTGTATATAACTTAGCAGTAGTACTAGACA
CAATAGGAAAAAAAATTCACCCAGTTGCGTACATGAACATAGCTGCATTCTTACAAAAAGCTGATAAAGA
ACGTTCAGGCGTAGTATCAACAATGAACTCATCTCTAGAACTATGGGCAAATCCATTAATAGACACAGCT
ACAGCATCTAGTGATTTCAATATTCAAGATTTTAAAAGAAAAAAAGTTACAGTATATGTTGGATTAACAC
CAGATAATCTAACTCGTCTCAGACCTTTAATGCAAGTTTTTTATCAACAAGCTACCGAATTTTTATGTAG
AAATTTACCATCAGATGACGAACCGTATGGTGTATTATTCTTAATGGACGAGTTTCCAACACTTGGAAAA
ATGGAGCAATTTCAAACTGGTATTGCATATTTCCGTGGATATAGGGTAAGATTATTTTTAATAATTCAAG
ATACAGAACAGCTCAAAGGTATATACGAAGAAGCAGGAATGAATTCATTCTTATCAAACTCCACTTACAG
AATTACTTTTGCAGCAAATAATATTGAAACTGCAAACTTAATATCACAACTTATAGGAAATAAAACTGTT
AATCAAGAATCTTTAAACAGACCAAAATTCTTAGATCTCAATCCAGCATCTCGTTCATTACATATATCAG
AAACACAAAGAGCACTGTTATTACCACAAGAAGTAATAATGTTACCTAGAGATGAACAAATACTGTTAAT
AGAGTCTACTTATCCTATAAAGTCGAAAAAGATAAAATATTTCGAAGACAAAAACTTTACAAAAAAATTA
TTAAAAAGTACTTTTGTTCCTACTCAAGAACCTTACGATCCTAATAATATAAAACCAACATATAAAGAAA
ATGAAAATACTATACCAAGCCTTGAAGGTAATATTCCTGCTAAAACTGATAACCAAGAACATAGTATGTA
TGAGAGCATAGAAGAAGAACCTGATAATTATGATGATGATTTTGATTTTGATGATTTAGATGAATACACA
GATGAAGATTATAATCAAGAGTTCGATGATGAAAATTATGACCAACATGATGATATATATGACCATAAGT
TAGATACATACAAAGAAAACATTGATGAAGATGAAGATGAAGATGAAAATGAATACGAAGAAGATGATGA
AAGTAATGAAGAAGATGTATATGATGATTACCAAAATGAGTATCATAAGAATACAGACAATACTGAAAGT
GATACAAACGAAATTAACATGGAATATGATCACAATATAGATCAAAGTGAAGACCAACATCATGAACAAT
ACAACAGAAATACTGATCACATAAATGAAGGTACAGATGATTATGATGACCTAGATCATCAATATGAAGA
CGAAGACAACAAGGAAAGTAATGAGGATGAAGAAGAAAATAATAATCACATAAGTCAAAATGATTATCTT
TATGAAAATAATGACGTTGAGGAAGATATAAAGCAAACTGATAACAAAAAACCAAAAAAGAAAAATACTA
GTAAGAAGAAAAATGCTAAACAATAA
 Primer design