SecReT4
Protein ID: 57238757
T4SS name [ID]VirB [497]
Gene symbolvirB11
Locus tagErum0270
StrainEhrlichia ruminantium str. Welgevonden
Repliconchromosome [GenBank: NC_005295] [Browse all T4SS(s) in this replicon]
Location [Strand]33611..34609 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ5HCF0
KEGG IDeru:Erum0270, erw:ERWE_CDS_00140
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.6e-90, Aligned region: 12..311
Protein Sequence: 332 a.a.     [Download]
>gi|57238757|ref|YP_179893.1| type IV secretion system ATPase VirB11 [Ehrlichia ruminantium str. Welgevonden]
MTTSYAALNTYLEPLQAIFQEEGVNEISINQECEVWIENRGNIRCESIPVLNLSHLKALGRLIAQATEQK
ISEENPLLSATLPNGYRIQIVFPPACEATAVAMSIRKPSAMQLSLDDYEKMGAFDQAITENQQNTVDIEL
NKLLKQKKIKDFLEYAILHKKNIIISGGTSTGKTTFTNAALRTIPKDERLITVEDAREIVLNNHPNRVHL
ITSKGGQGRAKVSIQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPMMALEQLK
LMVMQAGLGIPPDQIINYITNIVDIVIQLKRGSSGVRYVSEILFTKSLQKND
 
Nucleotide Sequence: 999 bp     [Download]
>gi|57238731|ref|NC_005295.2|:c34609-33611 Ehrlichia ruminantium str. Welgevonden chromosome, complete genome
ATGACAACAAGTTATGCAGCTTTAAATACATATCTTGAACCATTACAGGCTATCTTTCAGGAAGAAGGAG
TAAATGAAATATCTATAAACCAAGAGTGTGAGGTGTGGATAGAAAATCGAGGAAATATACGTTGTGAATC
TATACCAGTTCTCAATCTATCACACCTAAAAGCATTAGGAAGATTAATTGCCCAGGCTACAGAACAAAAA
ATAAGTGAGGAAAATCCCCTATTATCAGCAACATTACCTAATGGCTATCGTATACAGATAGTTTTTCCTC
CAGCATGTGAAGCAACTGCAGTTGCTATGTCAATAAGGAAACCATCAGCTATGCAGCTTTCCTTAGATGA
CTATGAAAAAATGGGAGCATTTGACCAAGCCATAACAGAAAATCAACAGAATACCGTAGATATTGAACTC
AATAAATTATTAAAACAAAAAAAAATCAAAGACTTTTTAGAGTATGCAATATTACATAAGAAAAACATAA
TAATAAGTGGTGGTACATCAACGGGAAAAACAACTTTTACTAATGCGGCATTACGTACCATACCAAAGGA
TGAAAGGTTAATTACAGTAGAGGATGCAAGAGAAATTGTTTTAAATAATCATCCAAATCGAGTACATCTT
ATAACATCCAAAGGAGGGCAAGGTAGAGCTAAAGTAAGTATTCAAGATCTAATAGAAGCATGCTTAAGGT
TACGTCCAGATAGAATAATAGTTGGAGAGCTACGTGGAGCAGAAGCTTTTAGTTTCCTAAGAGCAATTAA
TACAGGACACCCTGGATCAATATCTACTCTACATGCTGATACACCAATGATGGCTCTTGAACAATTAAAA
CTTATGGTTATGCAAGCAGGTCTTGGTATTCCTCCTGATCAAATTATCAATTATATAACCAATATAGTTG
ATATTGTAATACAATTAAAACGTGGATCATCTGGTGTAAGATATGTATCAGAAATACTGTTCACTAAATC
TTTACAGAAAAATGATTAA
 Primer design