SecReT4
Protein ID: 57238760
T4SS name [ID]VirB [497]
Gene symbolvirB8
Locus tagErum0300
StrainEhrlichia ruminantium str. Welgevonden
Repliconchromosome [GenBank: NC_005295] [Browse all T4SS(s) in this replicon]
Location [Strand]36787..37485 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDQ5HCE7
KEGG IDeru:Erum0300, erw:ERWE_CDS_00170
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-50, Aligned region: 23..230
Protein Sequence: 232 a.a.     [Download]
>gi|57238760|ref|YP_179896.1| hypothetical protein Erum0300 [Ehrlichia ruminantium str. Welgevonden]
MFKFGKKNKVSKSSSIPQSENLAHSWHVSRYSSILIQRNILLFLTMLALCTVGVSVFVISNISKSRTIEP
FVVEIEKKSGITTLVNPISVKQYSADEVLNNYFIIEYVRSRELFDPNNFQYNYYTKVRLLSDQTTYAEFR
RWTRLSNPASPLNLYANVTSGILKIRSLQHLRPGNVQIRFSLEFNTPNGVVKKDRIATLSFQYATLEMNE
QERQVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|57238731|ref|NC_005295.2|:c37485-36787 Ehrlichia ruminantium str. Welgevonden chromosome, complete genome
ATGTTTAAATTTGGAAAAAAGAATAAGGTAAGTAAGAGTAGTAGTATACCACAGAGTGAAAACTTGGCAC
ATAGCTGGCATGTAAGTCGCTACAGTTCCATTCTTATACAAAGAAATATACTATTATTTCTTACTATGTT
AGCATTGTGTACAGTAGGAGTTAGCGTTTTTGTAATTTCTAACATAAGTAAAAGTAGAACTATAGAACCA
TTTGTAGTAGAAATAGAAAAAAAATCTGGTATTACTACATTAGTTAATCCAATCTCAGTAAAACAATACT
CAGCAGATGAAGTTTTAAACAATTATTTTATAATAGAGTATGTAAGATCAAGAGAACTTTTCGATCCTAA
TAATTTTCAATATAATTATTATACAAAGGTTCGTTTGCTATCTGATCAAACAACATATGCAGAATTTCGT
AGATGGACAAGATTAAGCAATCCTGCAAGTCCTTTAAACTTATATGCAAATGTAACTTCAGGTATTTTAA
AAATTAGATCATTACAACACTTACGTCCAGGAAATGTACAAATAAGGTTCTCTTTAGAGTTCAATACCCC
AAATGGGGTAGTGAAAAAAGATAGGATAGCTACTTTGTCATTCCAATATGCAACTCTCGAAATGAATGAG
CAAGAACGTCAAGTCAATCCTTTAGGATTTCAAATAACTTACTATAGGGCAGATGATGAATTTTTATAA
 Primer design