SecReT4
Protein ID: 57650488
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1577
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1611280..1613127 [-]
Producthypothetical protein
Component typeYddG
UniProt IDQ5HFP0
KEGG IDsac:SACOL1577
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 615 a.a.     [Download]
>gi|57650488|ref|YP_186417.1| hypothetical protein SACOL1577 [Staphylococcus aureus subsp. aureus COL]
MKHKSVYLLCFLILPILLLTSVSAYAVSNPVGEPSHAVKPKIEKYDLSHYRSIYSEKGDWNPFGQEEISR
QINNVSDFFFSMTKILAGVTDYAIENLFQLDVINDFADKIGDFVGDIYQKLLSNLAITLFIIVCFNAFII
FSVQGNAREALKRAFLIMCLIGFGVGILANAGNIIRGTNNIGKDLNNIIMNSTSSIDGNIDYIHENSGMN
HIRNQLFDMTIYRTYLVMNYGTVDEKEIKAKGKDRIDNILKQDFSKKGQDEIDKIVKNEVEKKDNKYMTQ
GYVFQKLAISVIGFIITVFMSIVFLSISFAKLIFSTFALFLFLFLVFSWIVSFIPGFELSVFSAFAKTLG
YIILSACMTFLFVIVGLCIKLANSFIEPDSQNAYFLNSIFIIVILFVMYKKRAQIINFVSRGNISFSPSA
IGAGVMNRTQERFNKIRHEQAQNKKAKRENQRDEPAPPLQNDNDLRRRQQDKPMPLFINKDNQKNGNKRR
EQQESMNGNDVKSASVESNANDYSKQPQKASQQEHQVRETRQRKDIQRSPQVVNQPLNNENHSINRKEQK
SVQTAYDTDVQKRQIQNATQNQQSRQSGNRNQPITRNSQSKDRLKEQKDINKHGK
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1613127-1611280 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
ATGAAGCATAAAAGTGTGTATCTTTTATGCTTTTTAATTTTGCCTATTCTGCTTTTAACATCTGTGAGTG
CTTACGCTGTTTCTAATCCAGTTGGAGAGCCCTCACATGCAGTTAAGCCCAAAATTGAAAAGTATGATTT
ATCACATTATCGTTCAATATATAGTGAAAAAGGCGACTGGAATCCGTTTGGTCAAGAAGAAATTTCACGA
CAAATTAATAATGTGTCAGATTTTTTCTTTTCTATGACTAAGATTTTAGCAGGTGTTACAGATTATGCGA
TTGAAAATTTATTTCAACTAGATGTTATTAATGATTTTGCGGATAAAATCGGCGATTTTGTTGGCGATAT
ATATCAAAAGTTATTGAGTAATTTGGCAATAACATTATTTATTATTGTTTGTTTTAACGCATTTATTATT
TTTAGTGTACAAGGTAATGCAAGAGAAGCATTAAAGCGAGCGTTTTTAATTATGTGTTTGATTGGTTTTG
GTGTTGGTATACTTGCGAATGCAGGTAATATTATACGTGGTACAAACAATATTGGTAAGGATTTGAATAA
TATAATTATGAATAGTACATCTTCTATTGATGGGAACATTGATTATATTCATGAGAATTCAGGTATGAAT
CATATACGTAATCAATTATTTGATATGACGATATATAGAACATATTTAGTAATGAATTATGGAACTGTAG
ACGAAAAAGAGATAAAAGCAAAAGGTAAAGACCGTATTGATAACATTTTAAAACAAGATTTTTCAAAAAA
AGGACAAGATGAGATTGATAAAATTGTAAAAAATGAGGTTGAGAAAAAAGATAATAAATATATGACGCAA
GGTTATGTATTTCAAAAGTTGGCTATTTCAGTTATTGGCTTTATTATTACTGTTTTTATGTCAATTGTAT
TTTTATCAATTAGTTTTGCGAAGTTGATTTTTTCTACATTTGCTTTATTTTTATTCTTATTTTTAGTATT
CAGTTGGATAGTGAGTTTTATACCAGGATTTGAATTATCTGTTTTCTCTGCGTTTGCAAAAACGTTAGGC
TATATTATTTTAAGTGCCTGTATGACATTCTTATTTGTGATAGTTGGTTTGTGTATCAAGCTTGCAAATA
GTTTTATTGAACCGGATAGTCAAAATGCTTATTTTTTAAATTCAATATTTATAATTGTAATATTGTTTGT
AATGTATAAAAAACGGGCTCAAATTATCAATTTTGTAAGTCGTGGTAATATTAGTTTTTCTCCTAGTGCA
ATTGGTGCTGGTGTGATGAATCGAACACAAGAACGTTTTAATAAGATTCGTCATGAACAAGCGCAAAATA
AGAAAGCTAAACGAGAAAATCAAAGAGATGAACCCGCCCCACCACTTCAAAATGATAATGATTTAAGAAG
AAGACAGCAGGATAAACCAATGCCTTTATTTATAAATAAAGATAATCAAAAAAATGGTAATAAGCGAAGA
GAACAACAAGAGTCAATGAATGGTAATGATGTAAAATCTGCTTCTGTTGAATCAAATGCAAATGATTATT
CTAAACAACCACAAAAAGCATCACAGCAAGAGCATCAAGTACGAGAAACAAGACAGCGAAAAGATATACA
AAGGTCGCCACAAGTGGTTAATCAGCCATTAAATAATGAGAATCATTCAATAAATCGTAAAGAACAGAAG
TCAGTTCAAACTGCTTATGATACTGATGTTCAAAAACGACAAATACAAAATGCGACACAGAATCAACAAA
GTAGACAATCTGGAAATCGTAATCAACCTATTACACGTAATTCTCAGTCAAAAGACCGTCTAAAAGAGCA
AAAGGATATCAATAAGCATGGTAAATAA
 Primer design