SecReT4
Protein ID: 57650489
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1578
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1613132..1614490 [-]
ProductFtsK/SpoIIIE family protein
Component typeYdcQ
UniProt IDQ5HFN9
KEGG IDsac:SACOL1578
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.1e-23, Aligned region: 209..369
Protein Sequence: 452 a.a.     [Download]
>gi|57650489|ref|YP_186418.1| FtsK/SpoIIIE family protein [Staphylococcus aureus subsp. aureus COL]
MAMNEIALFKGVRIQPYQKYIDFMFASVLAFIFLVYRIYILFIDYKSVNKKLDILTLFAYFKPHLLYLLI
GTAIIFVICKLIAQLLIRFKTKDLAEMIETQGFHNRTVIKKTTEYIPIDYKQTEYDYYPTMFYKRGKKTF
VIHIKKDGSRFQDNYLELETIIEPMFNSELVEKKHIGRYLRYEFMPLKYKKRIVMNGEQESNTIFYDTKI
AITHQITWDFVKAPHGLVTGITGGGKTYFLFYVIRELFRRHSEVRLLDPKVSDLSFMKRVIGDDKVADTK
GQILKQLREANNEMEERFRLMNDSSDYKIGNDFRNFDMRPYFIIFDEVTAFTSTLDKKELQEMNDYLINI
IMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSLGNLSNDGYRMTFGQTDKEFQTIHDSDIGRGYIT
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKE
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1614490-1613132 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
ATGGCAATGAATGAAATTGCTTTATTTAAAGGCGTACGTATACAGCCTTATCAGAAGTATATTGATTTTA
TGTTTGCAAGTGTATTAGCATTTATTTTTTTGGTATATCGTATATACATTTTGTTTATTGATTATAAATC
AGTTAATAAAAAATTGGATATATTGACGTTGTTTGCATATTTTAAACCGCATTTATTGTATTTATTAATT
GGTACAGCAATTATATTTGTTATATGTAAGCTTATCGCTCAGCTTTTAATTCGTTTTAAAACAAAAGATT
TAGCTGAAATGATTGAAACACAAGGCTTTCATAATCGTACAGTAATCAAGAAAACAACCGAGTATATCCC
TATTGATTATAAACAAACTGAATATGACTATTATCCAACGATGTTTTATAAACGTGGTAAAAAAACTTTT
GTTATTCATATTAAAAAAGACGGTTCGAGGTTTCAAGATAATTATTTAGAGTTAGAAACGATTATTGAAC
CAATGTTTAATTCTGAATTAGTAGAAAAAAAGCATATTGGTCGTTATTTGAGATATGAATTTATGCCACT
TAAATATAAAAAGCGTATTGTTATGAATGGCGAACAAGAATCAAATACAATTTTTTATGATACAAAAATT
GCTATTACGCATCAAATTACTTGGGATTTTGTGAAAGCACCTCATGGATTGGTTACAGGTATAACCGGAG
GTGGTAAAACATATTTTTTATTTTATGTGATTCGTGAGTTATTCCGTAGACATTCAGAAGTACGTTTATT
AGACCCAAAAGTTTCAGATTTAAGCTTTATGAAGCGCGTTATTGGTGATGATAAAGTTGCAGATACTAAA
GGTCAAATATTAAAACAATTGAGAGAAGCTAATAATGAAATGGAAGAGCGTTTTAGATTAATGAATGATA
GTTCGGATTATAAAATCGGAAATGATTTCCGTAATTTTGATATGCGCCCCTATTTCATTATTTTTGATGA
GGTAACGGCTTTTACTTCAACTTTAGATAAAAAAGAATTACAAGAAATGAATGATTATTTAATTAATATT
ATTATGAAAGGTCGTCAAGCTGGTGTATTTATGTTTTTAACAGCACAAAGACCAGATGCAGATGTGATTA
AAGGTAATGTGCGTGACCAATTAGGGTTACGTGTGTCTTTAGGTAATTTGTCAAATGATGGTTATCGTAT
GACCTTTGGTCAAACTGATAAAGAATTTCAAACGATTCATGATAGTGATATCGGCCGAGGTTATATAACT
ATACTTGGACAATATAATGAACCAATTTTATTTGATGCACCTTTAATGGAACAATATGATTTTGTGGAAG
ATGTGAAACAAATATTAAATAAGGAGTGA
 Primer design