SecReT4
Protein ID: 57650490
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1579
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1614544..1617039 [-]
Producthypothetical protein
Component typeYddE
UniProt IDQ5HFN8
KEGG IDsac:SACOL1579
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-24, Aligned region: 460..768
DUF87 [PF01935], Evalue: 2.9e-06, Aligned region: 460..637
Protein Sequence: 831 a.a.     [Download]
>gi|57650490|ref|YP_186419.1| hypothetical protein SACOL1579 [Staphylococcus aureus subsp. aureus COL]
MNLKAPYAGLRDNLLLTKTGEVWAYYRVRSESISTANYDAKEESKKRMRYFLESIKGYQDFHFEMYDHDL
DLRNKFKEISKDFDDEAFNVAEYYSKETIDVLEQELQMITHNSFVMGVKIRELADDAVTLKEILKSTLSD
TAERIVSNFGFDVNLDDKILDKYKTFERDLADSFLGIGGERLTENELAYIIRKPFISNATHDVQEESSRR
AITDIYNAVIDPTRLSVLEVENDNEKFYTTTVVVDDFPLDMEYTHLFEKAQNMPFPVECHVKAKIINNEK
VKKKFDRAKINHKQQAKEKQDTGDSASEDVQDNLFVLNQMEREVTGSGVFIEWVFMFVIKSDDYRDCKRK
AKRLMKRLKETQIYAVNPLADQLQLFYQCLHGNDLFINKYWLQRTTATGIAENLFGVSQSLGTKTGFYIG
RIDKFIRSVSREEAVASSRDIILFSLLLAAKGIKGAVSDSPHVLITGQTGKGKSFLAKLLWIYTSFFKGQ
MLYWDPKSEFAEWFDRVTESKEMQEKYPLFINHLKTFKYVTLNYEDSTNYGCLDPIVFLDGIEANEMLKS
VFDEIKSFENYHHIETAIYQAISDTVEERENGKKVGSLNVIEKLQNNEDEHVKNAGDLLFEKTQNNILKL
VFSDGTNPALNIQEKATILQVKGLDMPKADDDTSSYSTSEKNGITLMLLIGKFLEKFGSRRDVQTTIFID
EGWAFSASRQGKKVGKRIKRTGRSENNSLVFITQSVKDKADDDGGNFGCHFAFDEKDEREDILKSLGLEY
SKESPENMEMLKDLKKGQCIFSDFYGRVGKMVVHCPFEEMTEAFRTQEDSASSKAEEKFAM
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1617039-1614544 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
ATGAATTTAAAAGCACCGTATGCAGGTTTAAGAGATAATTTGTTATTAACGAAAACTGGCGAAGTTTGGG
CGTATTATCGTGTTCGTTCTGAGTCTATATCAACAGCAAATTATGATGCAAAAGAAGAATCAAAAAAGCG
TATGCGTTATTTTTTAGAGTCGATTAAAGGTTATCAAGATTTTCATTTTGAAATGTATGACCACGATTTA
GATTTGCGAAATAAATTTAAAGAAATTAGTAAAGATTTTGATGATGAAGCTTTTAATGTAGCTGAATATT
ATTCAAAAGAAACTATTGACGTATTAGAACAAGAATTACAAATGATTACGCATAATTCTTTTGTTATGGG
TGTTAAAATACGTGAATTAGCTGACGATGCAGTTACACTTAAAGAGATTTTAAAAAGTACATTATCAGAT
ACGGCTGAGCGTATTGTTTCGAATTTTGGTTTTGATGTGAATTTAGACGATAAAATTTTAGATAAGTATA
AAACATTTGAACGAGATTTGGCTGATAGTTTTCTAGGTATTGGAGGCGAGCGTTTAACTGAGAATGAATT
GGCTTATATTATTAGAAAGCCTTTTATTTCAAATGCAACACATGACGTACAGGAAGAATCTTCAAGAAGA
GCTATTACAGATATTTATAATGCAGTAATTGACCCTACTCGCTTGAGTGTTTTAGAAGTTGAAAATGATA
ACGAGAAATTTTATACAACAACAGTTGTTGTTGATGATTTTCCGTTAGATATGGAATATACACATTTATT
TGAGAAAGCTCAAAATATGCCTTTTCCGGTTGAATGCCATGTAAAAGCAAAAATCATTAATAATGAGAAA
GTTAAGAAAAAATTTGACCGTGCGAAAATAAATCATAAACAACAAGCAAAAGAAAAGCAAGATACTGGCG
ACAGTGCTTCGGAAGATGTTCAAGATAATTTGTTTGTATTGAATCAAATGGAACGAGAAGTGACTGGCTC
AGGTGTATTTATTGAGTGGGTATTTATGTTTGTAATTAAAAGTGATGATTATAGAGATTGTAAACGTAAA
GCAAAGCGTTTGATGAAACGATTAAAGGAAACTCAAATATATGCAGTTAATCCATTAGCTGACCAGTTAC
AATTGTTTTATCAATGTTTACATGGTAATGATTTATTTATTAATAAGTATTGGTTACAAAGAACAACGGC
AACAGGTATAGCAGAGAATTTATTTGGTGTGTCTCAAAGTTTGGGAACAAAAACGGGTTTTTATATAGGG
CGTATTGATAAATTTATACGTTCTGTTTCACGTGAGGAAGCTGTTGCAAGTTCAAGGGATATAATTTTGT
TTAGTTTATTGTTGGCCGCAAAAGGTATTAAGGGGGCTGTCAGTGATAGTCCGCATGTTTTAATTACTGG
TCAAACTGGTAAAGGTAAATCATTTTTAGCAAAATTATTATGGATTTATACATCATTTTTTAAAGGTCAA
ATGTTGTACTGGGATCCAAAATCTGAGTTTGCAGAATGGTTTGACAGAGTAACAGAAAGTAAGGAAATGC
AAGAAAAGTATCCCCTATTTATTAATCATTTAAAAACATTTAAATATGTAACATTGAATTATGAAGATTC
AACCAATTATGGTTGTCTAGACCCTATTGTATTTTTAGATGGTATTGAAGCTAATGAGATGTTGAAATCA
GTGTTTGATGAAATTAAATCTTTTGAAAATTATCATCATATTGAAACAGCAATTTATCAAGCTATTTCTG
ATACGGTTGAAGAACGTGAAAATGGTAAAAAAGTTGGTTCATTAAATGTAATTGAAAAATTACAGAATAA
TGAAGATGAGCATGTAAAAAATGCAGGCGATTTATTATTTGAAAAAACGCAAAACAATATTTTAAAACTT
GTTTTTAGTGATGGTACGAATCCAGCTTTAAATATTCAAGAAAAAGCAACTATTTTACAGGTTAAAGGTT
TAGATATGCCTAAAGCAGATGATGATACATCAAGTTATTCAACAAGTGAGAAAAATGGGATTACATTAAT
GTTATTAATTGGTAAGTTTTTAGAGAAATTCGGTTCTCGTAGAGATGTTCAAACGACTATATTTATTGAT
GAGGGTTGGGCTTTTAGTGCTTCAAGACAAGGTAAAAAAGTTGGTAAGCGTATAAAAAGAACGGGACGTT
CTGAGAATAATTCACTTGTATTTATTACACAATCGGTAAAAGATAAAGCAGATGATGATGGTGGTAACTT
TGGTTGTCATTTTGCATTTGATGAAAAAGATGAACGTGAGGATATTTTAAAATCTTTAGGCTTAGAATAT
TCAAAAGAATCTCCTGAAAATATGGAGATGTTGAAAGATTTGAAGAAAGGTCAATGTATATTCAGTGATT
TTTATGGACGTGTTGGAAAAATGGTTGTACATTGTCCATTTGAGGAAATGACTGAAGCATTTAGAACACA
AGAAGATTCTGCAAGCTCTAAAGCTGAAGAAAAATTTGCGATGTAA
 Primer design