SecReT4
Protein ID: 57650491
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1580
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1617074..1617457 [-]
Producthypothetical protein
Component typeYddD
UniProt IDQ5HFN7
KEGG IDsac:SACOL1580
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.1e-20, Aligned region: 7..111
Protein Sequence: 127 a.a.     [Download]
>gi|57650491|ref|YP_186420.1| hypothetical protein SACOL1580 [Staphylococcus aureus subsp. aureus COL]
MDKKAYNLKRTFEQPIVMYEFTDKFRINKGFRLDFWATFLIVWFILFLLFWYLLQPVIMSIGGLMFIYFT
VAPYYITKYIVKLKQDGKKLFFFLWDFVIFVFNVQLRKVKLSYDEEVEYHDKKITFK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1617457-1617074 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
TTGGATAAAAAAGCTTATAATTTAAAGCGAACTTTTGAACAACCGATAGTTATGTATGAATTTACAGATA
AGTTTCGTATTAATAAGGGTTTTCGTTTAGATTTTTGGGCTACATTTTTGATTGTGTGGTTTATATTATT
TTTGTTATTTTGGTATTTATTACAGCCTGTAATTATGTCGATTGGTGGACTTATGTTTATTTACTTTACG
GTTGCACCTTATTATATAACGAAATATATTGTTAAGTTAAAACAAGATGGAAAGAAATTATTTTTCTTCT
TATGGGATTTTGTAATATTTGTTTTTAATGTGCAGTTAAGAAAAGTTAAATTAAGTTATGATGAAGAAGT
AGAATATCATGATAAAAAAATAACATTTAAATAG
 Primer design