SecReT4
Protein ID: 57650492
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1581
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1617469..1617729 [-]
Producthypothetical protein
Component typeYddC
UniProt IDQ5HFN6
KEGG IDsac:SACOL1581
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|57650492|ref|YP_186421.1| hypothetical protein SACOL1581 [Staphylococcus aureus subsp. aureus COL]
MSGLFNFFVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGGFLFLVSKGPE
QVFNAIAGVWKMIFGG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1617729-1617469 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
ATGAGTGGTTTATTTAATTTTTTTGTTTTAGGTGCTGACCGTCCATCACTTGGTGGAGTTGGTGACTGGA
TAAGTAATGAAGTAGGTACGGGTATTGGTTTAGTAGTATTGGTTGTTGGTATTGTAAAATGGGCTAGTGG
TAAATATGGGCATATGGTTATATTATTTGTTGTTGGTGGCTTTTTATTCTTAGTTTCTAAAGGTCCTGAA
CAGGTATTTAATGCGATTGCAGGTGTTTGGAAAATGATTTTTGGCGGTTGA
 Primer design