SecReT4
Protein ID: 57650493
T4SS name [ID]Ydd [620]
Gene symbol-
Locus tagSACOL1582
StrainStaphylococcus aureus subsp. aureus COL
Repliconchromosome [GenBank: NC_002951] [Browse all T4SS(s) in this replicon]
Location [Strand]1617734..1618789 [-]
Producthypothetical protein
Component typeYddB
UniProt IDQ5HFN5
KEGG IDsac:SACOL1582
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 4.5e-48, Aligned region: 98..343
Protein Sequence: 351 a.a.     [Download]
>gi|57650493|ref|YP_186422.1| hypothetical protein SACOL1582 [Staphylococcus aureus subsp. aureus COL]
MKIISKYILTRFSKNGKHFDIPKEQRRVIPKFKNRRKMIVICFYSLLAILLILLLASFIKATRANNDSKE
AVNKTNMIQKKYEDNANTVQYSPKLKLYADKFIDTYMNISKDSKELESREKELLKYFPSDYKKPDEKISD
TERKLNSKEFYNIKRKDKQTIIQYIVNYDVNITEKKEVKVKKKKKSEKDKDEYETKTEEKQRKVNQNILI
NIPIKSENNKYVVVEYPYFTPIPDSQLNKAKMVEDNLKDNKREDNPKAKAFIEDFFNKYASSKSDDMAYL
MDNPEGLEGTREVSQIREIRLYPKGDDYVAKVEILMKDKDSPLENLEHYTLDITKKDGKYYVKNMTNSIG
G
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|57650036|ref|NC_002951.2|:c1618789-1617734 Staphylococcus aureus subsp. aureus COL chromosome, complete genome
ATGAAAATAATAAGCAAGTACATTTTAACACGATTTTCTAAAAACGGAAAGCATTTTGATATTCCTAAAG
AACAACGCCGAGTAATTCCAAAATTTAAAAATCGTCGTAAGATGATTGTAATTTGTTTTTACTCATTATT
AGCTATTTTGTTAATTCTTTTATTAGCTTCTTTTATTAAAGCTACAAGAGCAAATAATGACAGTAAAGAA
GCAGTTAATAAAACGAATATGATTCAAAAAAAGTATGAAGATAATGCGAATACAGTTCAGTATAGTCCTA
AATTAAAGTTATATGCTGATAAGTTTATTGATACGTATATGAATATCTCGAAAGATTCAAAAGAATTGGA
ATCTAGAGAAAAAGAATTGTTGAAATATTTTCCATCAGATTATAAAAAACCTGATGAAAAAATTTCAGAT
ACAGAACGAAAATTGAATAGTAAAGAATTTTATAATATTAAACGTAAAGATAAACAAACAATTATACAGT
ATATTGTTAATTATGATGTGAATATTACTGAAAAGAAAGAAGTTAAAGTTAAGAAGAAAAAGAAAAGTGA
AAAAGATAAAGATGAGTATGAAACAAAAACAGAAGAAAAGCAACGTAAAGTAAATCAAAACATTTTAATA
AATATACCTATTAAGAGTGAAAATAATAAGTATGTTGTTGTTGAATATCCTTATTTTACGCCAATCCCTG
ATAGTCAATTGAATAAAGCTAAAATGGTTGAGGATAATTTGAAAGACAATAAACGGGAAGACAATCCGAA
AGCAAAAGCTTTTATTGAAGATTTCTTTAATAAATATGCTTCTAGTAAGTCTGATGATATGGCCTATTTA
ATGGATAACCCTGAGGGCTTAGAAGGAACTAGAGAAGTTTCTCAGATAAGAGAAATTAGGTTATATCCAA
AAGGCGATGATTATGTTGCTAAAGTTGAAATTTTGATGAAAGATAAAGATTCTCCTTTGGAGAATTTGGA
GCATTACACATTAGATATAACAAAAAAAGATGGTAAATATTACGTTAAAAATATGACTAATTCTATTGGA
GGTTAA
 Primer design