SecReT4
Protein ID: 58000363
T4SS name [ID]Tra_F [102]
Gene symboltraL
Locus tagO2R_45
StrainEscherichia coli plasmid pAPEC-O2-R (NC_006671)
Repliconplasmid pAPEC-O2-R [GenBank: NC_006671] [Browse all T4SS(s) in this replicon]
Location [Strand]37127..37438 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB7LI66, B7LWZ4, Q7B3W7
KEGG IDecz:pECS88_0067
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|58000363|ref|YP_190143.1| conjugal transfer pilus assembly protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|58000284|ref|NC_006671.1|:c37438-37127 Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design