SecReT4
Protein ID: 58000384
T4SS name [ID]Tra_F [102]
Gene symboltraQ
Locus tagO2R_24
StrainEscherichia coli plasmid pAPEC-O2-R (NC_006671)
Repliconplasmid pAPEC-O2-R [GenBank: NC_006671] [Browse all T4SS(s) in this replicon]
Location [Strand]22324..22608 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ5JBP1, B7LI83
KEGG IDecz:pECS88_0085
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.3e-51, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|58000384|ref|YP_190122.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMEGQQEGRHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|58000284|ref|NC_006671.1|:c22608-22324 Escherichia coli A2363 plasmid pAPEC-O2-R, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTTAT
TGCGGCCATTCTCGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCAGACATGTCTCTC
ATTAA
 Primer design