SecReT4
Protein ID: 58578681
T4SS name [ID]VirB [499]
Gene symbol-
Locus tagERWE_CDS_00170
StrainEhrlichia ruminantium str. Welgevonden
Repliconchromosome [GenBank: NC_006832] [Browse all T4SS(s) in this replicon]
Location [Strand]17736..18434 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDQ5HCE7
KEGG IDeru:Erum0300, erw:ERWE_CDS_00170
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-50, Aligned region: 23..230
Protein Sequence: 232 a.a.     [Download]
>gi|58578681|ref|YP_196893.1| hypothetical protein ERWE_CDS_00170 [Ehrlichia ruminantium str. Welgevonden]
MFKFGKKNKVSKSSSIPQSENLAHSWHVSRYSSILIQRNILLFLTMLALCTVGVSVFVISNISKSRTIEP
FVVEIEKKSGITTLVNPISVKQYSADEVLNNYFIIEYVRSRELFDPNNFQYNYYTKVRLLSDQTTYAEFR
RWTRLSNPASPLNLYANVTSGILKIRSLQHLRPGNVQIRFSLEFNTPNGVVKKDRIATLSFQYATLEMNE
QERQVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|58578664|ref|NC_006832.1|:c18434-17736 Ehrlichia ruminantium str. Welgevonden, complete genome
ATGTTTAAATTTGGAAAAAAGAATAAGGTAAGTAAGAGTAGTAGTATACCACAGAGTGAAAACTTGGCAC
ATAGCTGGCATGTAAGTCGCTACAGTTCCATTCTTATACAAAGAAATATACTATTATTTCTTACTATGTT
AGCATTGTGTACAGTAGGAGTTAGCGTTTTTGTAATTTCTAACATAAGTAAAAGTAGAACTATAGAACCA
TTTGTAGTAGAAATAGAAAAAAAATCTGGTATTACTACATTAGTTAATCCAATCTCAGTAAAACAATACT
CAGCAGATGAAGTTTTAAACAATTATTTTATAATAGAGTATGTAAGATCAAGAGAACTTTTCGATCCTAA
TAATTTTCAATATAATTATTATACAAAGGTTCGTTTGCTATCTGATCAAACAACATATGCAGAATTTCGT
AGATGGACAAGATTAAGCAATCCTGCAAGTCCTTTAAACTTATATGCAAATGTAACTTCAGGTATTTTAA
AAATTAGATCATTACAACACTTACGTCCAGGAAATGTACAAATAAGGTTCTCTTTAGAGTTCAATACCCC
AAATGGGGTAGTGAAAAAAGATAGGATAGCTACTTTGTCATTCCAATATGCAACTCTCGAAATGAATGAG
CAAGAACGTCAAGTCAATCCTTTAGGATTTCAAATAACTTACTATAGGGCAGATGATGAATTTTTATAA
 Primer design