SecReT4
Protein ID: 58584537
T4SS name [ID]VirB [500]
Gene symbol-
Locus tagWbm0279
StrainWolbachia endosymbiont strain TRS of Brugia malayi
Repliconchromosome [GenBank: NC_006833] [Browse all T4SS(s) in this replicon]
Location [Strand]365277..365960 [+]
ProductType IV secretory pathway, component VirB8
Component typeVirB8
UniProt IDQ5GT06
KEGG IDwbm:Wbm0279
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.9e-54, Aligned region: 19..225
Protein Sequence: 227 a.a.     [Download]
>gi|58584537|ref|YP_198110.1| Type IV secretory pathway, component VirB8 [Wolbachia endosymbiont strain TRS of Brugia malayi]
MLKFFKREKSNDSLDKDIDWNSSRYSTIIAQRNILLLFTLILLVAIFIGILAIFKISTSSTIEPFVIEIE
KKSGIVQLVDPVTVKQYSADEVLNNHFIAEYIKAREVFDPYNYNYNYYTKVRLFSSPNVYNEFKNYIRLQ
NMDDLLNLYSGFVKNDFKIRSTQKLDDDTFQVRFTVEFTREDGSSIRKNKIVIMSYRYAPLEMNDQQRYV
NPLGFQVTSYRVDDEYV
 
Nucleotide Sequence: 684 bp     [Download]
>gi|58584261|ref|NC_006833.1|:365277-365960 Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome
ATGCTAAAATTCTTTAAACGCGAAAAAAGTAATGATTCATTAGATAAGGATATAGATTGGAATTCAAGTC
GCTACAGCACAATTATTGCTCAGAGAAATATTTTACTTCTATTTACACTAATATTATTAGTGGCTATTTT
TATAGGCATATTAGCTATATTTAAGATTAGCACTAGCAGCACTATTGAACCGTTCGTTATAGAAATTGAA
AAAAAATCAGGAATAGTGCAATTAGTTGACCCTGTCACAGTAAAACAATATTCTGCGGATGAGGTACTAA
ACAATCATTTTATTGCAGAATACATAAAAGCAAGAGAAGTTTTTGATCCATATAACTACAATTATAACTA
TTATACAAAAGTGAGATTATTTTCCTCGCCTAATGTATATAATGAATTTAAGAATTACATAAGATTACAA
AATATGGATGACCTTTTGAATTTATATTCAGGCTTCGTCAAAAATGATTTTAAGATTCGCTCAACTCAGA
AATTAGATGACGATACTTTTCAGGTGAGATTTACTGTAGAATTTACACGAGAAGATGGAAGTTCTATAAG
GAAAAACAAGATAGTTATCATGTCATACAGGTATGCACCACTTGAAATGAATGATCAGCAAAGATATGTT
AACCCATTAGGGTTTCAAGTTACTTCTTATAGGGTAGATGATGAATATGTATAG
 Primer design