SecReT4
Protein ID: 58584540
T4SS name [ID]VirB [500]
Gene symbol-
Locus tagWbm0282
StrainWolbachia endosymbiont strain TRS of Brugia malayi
Repliconchromosome [GenBank: NC_006833] [Browse all T4SS(s) in this replicon]
Location [Strand]368268..369275 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ5GT03
KEGG IDwbm:Wbm0282
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.2e-87, Aligned region: 11..310
Protein Sequence: 335 a.a.     [Download]
>gi|58584540|ref|YP_198113.1| type IV secretion system ATPase VirB11 [Wolbachia endosymbiont strain TRS of Brugia malayi]
MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRSEIRCEKLEIFDLNHLKSLGRLIAQATEQKLS
EEAPLLSATLPNGYRIQIVFPPACEPDKVVMSIRKPSGLQLALDDYEKMGAFSETAIEVIDSPVNRHLNL
LLKQKKIKEFLEYAVMNKKNIIISGGTSTGKTTFTNATLRAIPAEERIITVEDAREIVLNDHPNRVHLIA
SKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPTMALEQIKLM
VMQANLGIPPDQIIPYIRNVIDIVIQLKRTSGGKRSVSEILFTKSSMKMLKFTHN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|58584261|ref|NC_006833.1|:368268-369275 Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome
ATGAACTATGCTGCACTTGACACATATTTAGAGCCATTACAAGGCATATTTCAAGAGGAAGGCGTAAATG
AAATATCAATAAATAAGCCAAAGGAAGTCTGGATTGAAAATCGCAGTGAAATAAGGTGTGAAAAACTAGA
AATATTCGATCTTAACCATCTAAAATCTCTTGGCAGACTAATTGCTCAAGCTACAGAACAAAAGCTTAGC
GAAGAAGCACCATTACTTTCAGCCACACTACCAAATGGTTATCGTATACAGATAGTATTCCCGCCAGCAT
GTGAGCCTGATAAAGTAGTCATGTCAATTCGTAAACCCTCTGGTCTACAATTAGCATTGGACGATTATGA
AAAAATGGGAGCTTTTTCTGAAACTGCTATAGAAGTAATTGATAGTCCAGTGAATCGCCACCTGAATTTG
CTGTTAAAGCAAAAGAAAATAAAAGAGTTTTTAGAATATGCTGTAATGAACAAGAAAAATATCATAATTA
GTGGTGGAACTTCTACCGGTAAAACCACTTTTACTAATGCTACTTTACGTGCTATTCCGGCTGAAGAAAG
AATTATCACTGTTGAGGATGCAAGGGAAATCGTTTTGAATGATCATCCAAACAGAGTGCACCTCATTGCC
TCCAAAGGAGGGCAGGGTAGGGCAAAAGTGACCACTCAGGACTTAATAGAAGCGTGCTTACGTTTAAGGC
CAGATAGAATAATAGTTGGTGAGCTCCGTGGAGCGGAAGCTTTTAGTTTTCTTAGGGCAATAAATACTGG
CCACCCTGGGTCAATATCGACCCTTCATGCGGATAGTCCAACAATGGCCCTCGAGCAAATAAAATTGATG
GTCATGCAAGCAAATCTTGGTATTCCTCCAGATCAGATTATACCATATATTAGAAATGTGATTGATATTG
TTATCCAGCTAAAAAGAACTAGTGGGGGAAAAAGAAGCGTTTCTGAGATATTATTTACTAAATCTTCGAT
GAAAATGCTTAAATTTACACATAATTAA
 Primer design