SecReT4
Protein ID: 58584541
T4SS name [ID]VirB [500]
Gene symbol-
Locus tagWbm0283
StrainWolbachia endosymbiont strain TRS of Brugia malayi
Repliconchromosome [GenBank: NC_006833] [Browse all T4SS(s) in this replicon]
Location [Strand]369289..371319 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ5GT02
KEGG IDwbm:Wbm0283
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.9e-152, Aligned region: 124..567
TraG-D_C [PF12696], Evalue: 4.6e-27, Aligned region: 407..529
TrwB_AAD_bind [PF10412], Evalue: 6.7e-26, Aligned region: 240..543
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 383..483
Protein Sequence: 676 a.a.     [Download]
>gi|58584541|ref|YP_198114.1| type IV secretion system component VirD4 [Wolbachia endosymbiont strain TRS of Brugia malayi]
MSHSGNHLRNILIGGVVAFSILEFCFYLSGILFYLFVDGPDGLDFKAIRPGLTPFPQALWPTIFDHIQNC
WHHPELYSLELKIKLIISSALPVVVLMIILWNLRERIIEWRPFRKKESLHGDSKWASEKEIRKAGLRSKK
GLLLGKDKRGYFIADGYQHALLFAPTGSGKGVGFVIPNLLFWTDSVIVHDIKLENYEITSGWRERQGQKV
YVWNPAQPDGISHCYNPLEWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKS
FGEVVRTMRSDDVVYNLAVVLDTMGKIIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTAT
ASSDFNILDFKRKKVTVYVGLTPDNLNRLKPLMQVFYQQATEFLCRKLPSDDEPYGVLFLMDEFPTLGKM
EQFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVQ
QESLNKPKFLDLNPASRSLHISETQRALLLPQEIIMLPRDEQIILIESTYPIKSKKILYYSDNTFTRKLL
KQTYVPTQEPYDPNKVFSGANKSKVDNKENDATEGPNAADYLVEAQTKDAVYDESEIDDELKEEEIDDED
VDGFDDEEDYGKLKGDGKPKEEKYDDEFDNEFEDEDDGDKPKSNGK
 
Nucleotide Sequence: 2031 bp     [Download]
>gi|58584261|ref|NC_006833.1|:369289-371319 Wolbachia endosymbiont strain TRS of Brugia malayi, complete genome
ATGAGTCATAGCGGGAATCATCTACGCAATATTTTAATAGGGGGTGTTGTGGCTTTTAGTATACTAGAAT
TTTGTTTCTATTTATCTGGTATACTGTTTTATCTATTTGTTGATGGTCCAGATGGTTTAGACTTTAAGGC
AATTCGCCCTGGATTGACGCCTTTTCCTCAAGCTCTTTGGCCAACAATTTTTGATCATATACAAAATTGT
TGGCATCATCCAGAGTTATATAGTCTCGAGCTTAAGATCAAATTAATTATATCTTCTGCATTGCCTGTTG
TTGTTTTAATGATTATTTTGTGGAATTTAAGAGAAAGAATAATCGAGTGGCGGCCGTTTAGAAAGAAAGA
ATCACTCCACGGAGACTCAAAATGGGCGTCAGAAAAAGAAATACGAAAGGCAGGATTAAGAAGTAAAAAG
GGGCTATTGCTTGGTAAGGATAAAAGAGGCTACTTCATTGCTGATGGATATCAACACGCGTTGCTATTTG
CGCCTACAGGTTCTGGTAAGGGTGTTGGTTTTGTAATTCCTAATTTATTATTTTGGACTGACTCAGTAAT
TGTACACGACATAAAATTAGAAAATTATGAAATAACAAGTGGTTGGCGAGAACGACAAGGGCAAAAGGTA
TACGTATGGAACCCAGCGCAGCCAGATGGAATAAGCCACTGCTATAATCCATTAGAATGGATTAGCGAAA
AACCTGGACAAATGGTTGATGATGTGCAAAAAATAGCCAACTTGATTATGCCTGAACAAGACTTTTGGCA
AAATGAAGCAAGAAGCTTATTTGTTGGAGTAGTATTATACCTACTTGCTGCACCAGAAAAAGTTAAATCT
TTTGGTGAAGTTGTGCGTACGATGCGTAGCGATGACGTAGTTTACAATCTTGCTGTTGTTTTGGACACAA
TGGGCAAAATAATACATCCTGTGGCATATATGAACATTGCTGCTTTTTTGCAGAAAGCTGACAAAGAAAG
GTCAGGTGTCGTCTCAACCATGAACTCATCTCTTGAGCTATGGGCAAACCCATTGATTGATACTGCAACT
GCATCAAGTGACTTTAATATTCTAGATTTTAAGAGGAAGAAAGTTACAGTTTATGTTGGGTTAACTCCAG
ACAACTTAAACAGGTTAAAACCTTTAATGCAAGTTTTTTACCAGCAAGCAACTGAGTTCTTGTGTAGAAA
ATTGCCGTCGGATGATGAGCCTTATGGCGTGTTGTTCTTAATGGATGAGTTTCCTACACTTGGAAAAATG
GAGCAATTTCAAACAGGTATTGCATATTTTCGTGGCTATAGAGTTAGATTATTCTTAATTGTTCAAGATA
CTGAGCAACTTAAAGGAATATACGAAGAAGCAGGAATGAACTCCTTTTTATCAAACTCAACTTATAGAAT
AACTTTTGCAGCTAATAACATTGAGACAGCTAACTTAATATCGCAACTTATAGGGAACAAAACTGTACAA
CAAGAATCATTGAACAAACCTAAATTTTTAGACTTGAATCCTGCATCAAGATCGTTGCATATCTCTGAAA
CGCAAAGAGCATTGTTGTTACCTCAAGAAATTATTATGTTGCCACGTGATGAACAGATAATTTTGATAGA
ATCGACTTACCCAATTAAATCAAAGAAGATCTTATACTACAGTGATAACACTTTCACAAGAAAACTACTC
AAGCAGACTTATGTACCTACACAGGAGCCATATGACCCAAACAAAGTTTTTTCTGGTGCTAACAAAAGTA
AGGTTGATAACAAAGAAAACGACGCTACTGAAGGGCCTAACGCTGCTGATTATCTTGTTGAGGCTCAAAC
TAAAGATGCAGTATACGATGAATCAGAGATCGATGATGAGCTTAAAGAAGAAGAGATCGATGATGAAGAT
GTTGACGGGTTTGATGATGAGGAAGATTATGGCAAACTTAAAGGCGACGGTAAACCTAAAGAAGAAAAAT
ATGATGATGAATTCGATAACGAATTTGAAGATGAAGATGATGGTGATAAACCAAAAAGTAATGGAAAGTA
A
 Primer design