SecReT4
Protein ID: 58616090
T4SS name [ID]Prg/Pcf [615]
Gene symbolprgF
Locus tagpCF10_21
StrainEnterococcus faecalis plasmid pCF10 (NC_006827)
Repliconplasmid pCF10 [GenBank: NC_006827] [Browse all T4SS(s) in this replicon]
Location [Strand]19545..19772 [+]
ProductPrgF
Component typePrgF
UniProt IDQ5G3P9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|58616090|ref|YP_195779.1| PrgF [Enterococcus faecalis]
MDIVTKIITLIGGIIGLVSAVSIMFGVKEIRSGMSNDDPRTLDKGIEKVVVGGAVILAIGGVVAYVITQV
GAIRF
 
Nucleotide Sequence: 228 bp     [Download]
>gi|113706804|ref|NC_006827.2|:19545-19772 Enterococcus faecalis plasmid pCF10, complete sequence
ATGGATATAGTCACAAAAATTATTACACTAATTGGAGGAATCATTGGACTTGTTTCAGCAGTTAGTATTA
TGTTTGGCGTGAAAGAAATTCGTTCAGGTATGTCGAATGATGATCCACGTACGCTTGATAAAGGAATAGA
AAAAGTAGTTGTTGGTGGGGCTGTTATTTTAGCAATTGGTGGGGTAGTCGCCTATGTTATTACACAGGTA
GGAGCTATTCGTTTTTAA
 Primer design