SecReT4
Protein ID: 58616094
T4SS name [ID]Prg/Pcf [615]
Gene symbolprgK
Locus tagpCF10_26
StrainEnterococcus faecalis plasmid pCF10 (NC_006827)
Repliconplasmid pCF10 [GenBank: NC_006827] [Browse all T4SS(s) in this replicon]
Location [Strand]23608..26223 [+]
ProductPrgK
Component typePrgK
UniProt IDQ5G3P4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 2.5e-25, Aligned region: 758..862
Protein Sequence: 871 a.a.     [Download]
>gi|58616094|ref|YP_195784.1| PrgK [Enterococcus faecalis]
MVENKRTWKEKVHVETQVEERLRKNLTLKSREATKLQKKALKTTKKEFKLSKKNYKQSLKKHKLTLKTGK
EPLSINHLLDKKKFVEQKKRKKAQKIAYKRTKKVDETRVVNQVKRETKEGLKREATQKVRTTLTQEDTLN
EAMTLYEKTQQAKFNMRTALKTGKTVKNLSVKTAKDTYGLGNRLFNFSRGRGFQRTPKDFTLKKQLMKQL
RNRAMRFKAAKEAKKAEQGIGLIRSFFNGQKTLGKVAALILKNPISWVVLLVLFLVFLLSGVASSTQKPA
IVQEEEDLTASWTYFTKLDAQHTDDNNLFYSNIDEVLFYMNYRYDDFKLLDMDSTGTKNFETILSELWTA
LNGKKPDYQLKTMQSLETDKKSSYFIEEEQAKHYQEIKKELGYQTLDDLLSFPVKTDALIVNKRYGYDKS
KEKLTLYQGIDVLIEDNQPFHSPMNGQIVSVPDTETLVIEKEKVARLTIRGVNTLRLTKGMDVEEGTFLG
NTKNSTVTFQYEKYKKETKDWFFVNPAFYFPRVTYTQTTLLGSADFSPGASVEKRAQAVYDYLSKKGYTK
EGISAILGNFSVESGINPKRAEGDYLNPPVGAHGNSWDEPSWLSMGGPQIYGGRFPNILHRGLGLGQWTD
TADGGRRHTLLLDYAKGKNKKWYDLQLQLDFIFDGDAPGSRTAADNVARSKVAATIPELTTYFLTVWEGN
PGDKLGERIQAAQNWFTFFSRSGTPIGGSGSEVFAQYKEKMQPLPTDRETKAGQGWPGNAYAPGNCTWYV
FNRFAQLGKSIHPTMGNANQWVHNYSQTPGATLESAPKKGDAVIFTNGVAGSSTQYGHVAYVEHVNSDGS
FVISEMNVSGEYSMNWRVLKKEAGEYFMRLN
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|113706804|ref|NC_006827.2|:23608-26223 Enterococcus faecalis plasmid pCF10, complete sequence
ATGGTAGAAAATAAGCGTACTTGGAAAGAAAAAGTACATGTTGAAACTCAAGTAGAAGAGCGTCTTAGAA
AAAATTTGACCTTAAAATCAAGAGAAGCGACGAAGTTGCAAAAAAAAGCGTTAAAGACGACTAAAAAGGA
GTTTAAACTTTCTAAGAAAAATTACAAGCAATCCCTAAAAAAACATAAACTTACCTTGAAAACAGGGAAG
GAACCCTTAAGTATTAACCATTTACTGGATAAAAAGAAATTTGTAGAGCAAAAGAAACGCAAAAAAGCAC
AGAAAATTGCTTACAAACGAACGAAAAAAGTAGATGAAACGCGTGTCGTTAACCAAGTGAAAAGGGAAAC
CAAGGAAGGGTTGAAAAGAGAAGCGACGCAAAAAGTACGAACCACGTTAACGCAGGAAGATACACTGAAT
GAAGCAATGACCCTTTATGAAAAAACACAACAAGCTAAATTTAACATGCGTACAGCTTTGAAAACAGGAA
AAACGGTTAAGAATCTTTCGGTGAAAACTGCAAAAGATACGTATGGATTGGGGAATCGCTTATTTAACTT
TTCAAGAGGACGTGGGTTTCAGCGCACACCAAAAGACTTTACGTTAAAAAAACAACTTATGAAACAACTA
CGGAATCGTGCTATGCGCTTTAAAGCAGCAAAAGAAGCGAAGAAAGCCGAACAAGGTATTGGCTTGATTC
GTTCTTTTTTTAATGGTCAGAAGACATTAGGGAAAGTCGCTGCATTGATTCTAAAAAATCCGATTTCTTG
GGTTGTTTTATTGGTTCTTTTTCTTGTTTTTTTATTGAGTGGCGTTGCAAGTAGTACACAAAAACCAGCG
ATTGTTCAAGAAGAGGAAGATTTAACCGCTTCATGGACGTATTTTACTAAATTAGATGCGCAACATACAG
ACGATAACAACTTGTTTTATAGCAATATCGATGAAGTTCTTTTCTACATGAATTATCGGTACGATGATTT
TAAATTATTAGATATGGATTCCACTGGTACAAAGAATTTTGAAACGATTCTATCTGAGCTATGGACGGCA
CTAAACGGAAAGAAACCTGATTATCAGTTGAAAACAATGCAAAGTTTAGAGACAGATAAGAAATCGAGTT
ATTTTATCGAAGAGGAACAAGCAAAGCATTATCAAGAGATAAAAAAAGAGTTAGGCTACCAAACATTGGA
TGATCTCCTTTCTTTTCCAGTAAAAACTGACGCTTTAATTGTCAATAAGCGCTATGGCTATGACAAATCA
AAAGAGAAGCTCACCTTATATCAAGGCATTGATGTATTGATTGAAGATAATCAGCCGTTTCATTCACCAA
TGAACGGCCAAATCGTTTCGGTGCCTGATACAGAAACGCTGGTTATCGAAAAAGAGAAAGTAGCTAGGTT
AACGATTCGTGGTGTGAATACCCTTCGACTAACAAAAGGTATGGATGTTGAAGAGGGAACATTTCTTGGG
AATACAAAGAATTCAACAGTTACATTCCAGTATGAAAAATATAAAAAAGAAACGAAAGACTGGTTTTTTG
TAAATCCAGCCTTTTATTTTCCACGTGTAACCTACACGCAAACGACTCTTTTAGGAAGTGCAGATTTTTC
TCCTGGAGCAAGTGTCGAAAAAAGAGCGCAAGCTGTTTATGATTATTTATCAAAAAAGGGATACACCAAA
GAGGGAATTAGCGCGATTTTAGGCAATTTTTCGGTAGAAAGTGGCATTAATCCAAAACGTGCAGAAGGGG
ATTATTTGAACCCGCCTGTAGGTGCGCATGGGAATTCGTGGGACGAACCGAGTTGGCTTTCTATGGGAGG
TCCGCAAATTTATGGGGGACGTTTTCCAAATATTCTCCATCGAGGACTAGGTTTAGGTCAGTGGACGGAT
ACAGCTGATGGTGGTCGTAGGCATACGTTGTTATTAGACTATGCCAAAGGTAAAAATAAAAAATGGTATG
ATCTGCAATTGCAACTGGACTTTATTTTTGACGGCGATGCACCAGGCTCACGAACAGCAGCAGATAATGT
AGCAAGAAGTAAGGTTGCTGCAACTATTCCAGAACTTACTACTTATTTTCTAACTGTTTGGGAAGGAAAT
CCCGGAGACAAGTTAGGAGAACGAATTCAAGCTGCACAAAATTGGTTTACATTCTTTTCTCGATCGGGTA
CACCAATCGGTGGTTCTGGGAGTGAGGTCTTTGCGCAGTATAAAGAAAAAATGCAACCATTACCCACAGA
CAGAGAAACAAAAGCAGGACAAGGCTGGCCAGGCAATGCGTATGCGCCAGGGAATTGTACTTGGTATGTG
TTTAATCGTTTTGCACAGTTAGGAAAAAGCATTCACCCTACTATGGGAAACGCCAATCAATGGGTGCATA
ACTACAGTCAAACGCCCGGAGCGACACTTGAATCGGCCCCTAAAAAAGGGGATGCTGTTATTTTTACAAA
TGGTGTAGCTGGTTCTAGTACGCAATATGGACACGTGGCTTATGTGGAGCATGTAAACTCTGATGGTAGT
TTTGTCATTTCTGAAATGAATGTCAGTGGTGAGTATTCTATGAATTGGCGTGTCTTAAAAAAAGAAGCAG
GCGAATACTTTATGCGCCTAAACTAA
 Primer design