SecReT4
Protein ID: 58616095
T4SS name [ID]Prg/Pcf [615]
Gene symbolprgL
Locus tagpCF10_27
StrainEnterococcus faecalis plasmid pCF10 (NC_006827)
Repliconplasmid pCF10 [GenBank: NC_006827] [Browse all T4SS(s) in this replicon]
Location [Strand]26247..26873 [+]
ProductPrgL
Component typePrgL
UniProt IDQ5G3P3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|58616095|ref|YP_195785.1| PrgL [Enterococcus faecalis]
MYNMEKLSRYKKIGFIGGSLLLIMLIFLIGLSVGQRKQVNTNEKQVKVEKKEELTTSTVKKFLIAYYTKK
DLGENRNRYEPLVTSAMYNELVNVEKQPVNQAYKGYVVNQVLDTYKIYIDTENNEVIVDVTYKNTQRTKR
NNDEGALKNQSNQEALKLTFVKQGANFLVDKMAPVTLTNELQEEPNSYNTHVVTTEESAKESANSGEK
 
Nucleotide Sequence: 627 bp     [Download]
>gi|113706804|ref|NC_006827.2|:26247-26873 Enterococcus faecalis plasmid pCF10, complete sequence
ATGTATAATATGGAAAAATTAAGTAGATACAAGAAAATTGGCTTTATTGGTGGCAGCTTACTGCTTATTA
TGCTTATTTTTTTGATTGGGCTTAGTGTTGGGCAAAGAAAACAAGTAAACACCAATGAAAAACAAGTAAA
AGTCGAGAAAAAAGAGGAATTAACAACAAGTACGGTAAAAAAATTTTTGATTGCGTATTATACAAAAAAA
GATCTTGGCGAAAATAGAAATCGCTATGAACCTTTGGTGACAAGCGCCATGTATAACGAATTAGTGAATG
TAGAAAAACAGCCTGTTAATCAAGCGTATAAAGGCTATGTAGTCAATCAAGTACTTGATACGTATAAAAT
CTATATTGATACTGAAAACAACGAAGTCATTGTGGACGTCACGTATAAGAATACACAACGAACCAAACGA
AATAATGATGAAGGAGCGTTGAAAAATCAGAGCAATCAAGAAGCGCTGAAATTAACCTTTGTAAAACAAG
GCGCTAATTTTTTAGTGGATAAAATGGCACCAGTAACACTTACCAATGAATTACAAGAGGAGCCAAATTC
ATATAATACACATGTAGTAACGACAGAAGAATCAGCAAAGGAGAGTGCAAACAGTGGGGAAAAGTAA
 Primer design