SecReT4
Protein ID: 58616249
T4SS name [ID]Tra_F [593]
Gene symboltraF
Locus tagp1B150
StrainAromatoleum aromaticum EbN1
Repliconplasmid 1 [GenBank: NC_006823] [Browse all T4SS(s) in this replicon]
Location [Strand]81125..82072 [-]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDQ5NX60
KEGG IDeba:p1B150
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.8e-65, Aligned region: 38..262
Protein Sequence: 315 a.a.     [Download]
>gi|58616249|ref|YP_195378.1| sex pilus assembly protein [Aromatoleum aromaticum EbN1]
MSFIRSGKPVRAILVSLAIVAATSSVHAQSFFKRGGEGYFWYETPPPPAEPVQLEKEPEPPASASPATET
AANTGTQPFSTAWLRDNLPVLLEKAMDSGKREDMEAYLYAQRIALDKAQNFAHLQQLVVKTDPILDENNR
MPLDTFIRQTVLATNKEQKDEVTKHLASKGGIFMFFDSSCSHCEKQFPVIGMLKERYGFETRFVSVDGKP
LPGMDNWIPDAGQFQSLNLKLTPTVVYAVPPNNFYVVAQGAMSASGLVDRLLVVAESEKLISDEMIAAVN
PAMRGVARIEDMVDGASDDPAEWVKLLKERLQGRY
 
Nucleotide Sequence: 948 bp     [Download]
>gi|58616149|ref|NC_006823.1|:c82072-81125 Azoarcus sp. EbN1 plasmid 1, complete sequence
GTGTCGTTTATCCGATCTGGTAAGCCTGTACGGGCGATTCTTGTTTCTTTAGCGATCGTAGCCGCAACCT
CGAGCGTTCACGCTCAAAGCTTCTTCAAGCGGGGAGGAGAAGGCTATTTCTGGTATGAGACCCCTCCCCC
TCCGGCTGAACCCGTTCAATTGGAAAAAGAACCCGAACCTCCAGCTTCGGCCTCTCCAGCCACTGAAACA
GCAGCTAATACGGGGACTCAGCCTTTCTCTACAGCGTGGCTCAGAGATAACTTGCCGGTTCTTCTTGAGA
AAGCGATGGATTCAGGAAAGCGTGAAGACATGGAAGCGTATCTGTACGCCCAAAGAATCGCGCTCGACAA
GGCGCAGAATTTTGCACATCTTCAACAACTCGTCGTCAAGACTGACCCCATTCTCGATGAAAATAACCGG
ATGCCCCTTGATACGTTCATCAGGCAAACAGTACTTGCTACGAACAAGGAACAAAAAGACGAAGTAACGA
AGCACCTTGCATCAAAGGGTGGCATCTTCATGTTCTTCGACTCGTCCTGCTCTCATTGCGAGAAGCAGTT
TCCTGTCATTGGCATGCTTAAAGAAAGGTATGGTTTTGAAACTCGGTTTGTATCTGTTGATGGCAAGCCC
CTTCCAGGTATGGATAACTGGATACCAGACGCAGGGCAGTTTCAGTCACTCAACCTAAAACTCACACCGA
CCGTTGTTTATGCTGTCCCGCCGAACAATTTTTACGTCGTTGCTCAAGGCGCCATGTCCGCAAGTGGGCT
TGTTGATCGCCTTCTAGTTGTGGCTGAGTCTGAGAAGCTGATATCAGATGAAATGATCGCAGCGGTCAAT
CCTGCCATGCGGGGCGTCGCACGAATTGAAGACATGGTTGATGGTGCGTCAGATGATCCGGCCGAATGGG
TTAAATTGTTGAAAGAACGCCTACAGGGGAGATACTAA
 Primer design