SecReT4
Protein ID: 58616260
T4SS name [ID]Tra_F [593]
Gene symboltraL
Locus tagp1B163
StrainAromatoleum aromaticum EbN1
Repliconplasmid 1 [GenBank: NC_006823] [Browse all T4SS(s) in this replicon]
Location [Strand]89901..90191 [-]
Productpilus assembly protein
Component typeTraL_F
UniProt IDQ5NX49
KEGG IDeba:p1B163
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.7e-11, Aligned region: 5..75
Protein Sequence: 96 a.a.     [Download]
>gi|58616260|ref|YP_195389.1| pilus assembly protein [Aromatoleum aromaticum EbN1]
MALEVDIPRYVDSQQQFYAWEFDEFIVGFTLFSVGILSRSTIGLFLGVAVMLISIRIMRRWKEGELEGAI
THVFYAKGFGGMNKVYTDGMRRRFWL
 
Nucleotide Sequence: 291 bp     [Download]
>gi|58616149|ref|NC_006823.1|:c90191-89901 Azoarcus sp. EbN1 plasmid 1, complete sequence
ATGGCGCTCGAGGTTGATATTCCCCGTTATGTCGATTCCCAACAACAGTTTTACGCATGGGAATTTGACG
AATTTATTGTCGGGTTTACTCTGTTCTCTGTTGGCATTCTCTCGCGATCAACGATCGGTCTATTTCTCGG
CGTTGCAGTGATGCTTATCTCTATTCGAATAATGAGGCGCTGGAAGGAAGGGGAACTCGAAGGCGCAATC
ACGCATGTTTTCTATGCAAAGGGTTTTGGCGGAATGAATAAAGTGTACACAGACGGGATGCGTCGGAGGT
TCTGGCTATGA
 Primer design