SecReT4
Protein ID: 58616434
T4SS name [ID]Trb [67]
Gene symboltrbC
Locus tagp2B3
StrainAromatoleum aromaticum EbN1
Repliconplasmid 2 [GenBank: NC_006824] [Browse all T4SS(s) in this replicon]
Location [Strand]13680..14105 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ5NWM5
KEGG IDeba:p2B3
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-19, Aligned region: 12..110
Protein Sequence: 141 a.a.     [Download]
>gi|58616434|ref|YP_195563.1| mating pair formation protein TrbC [Aromatoleum aromaticum EbN1]
MQVAVPSFRLDRNAVFYLGLLALLAFFLLAPHSAFASEGTGGSLPYESWLTNLRNSVTGPVAFTLALIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAAVPEDAIQHAKLAASVVLPKRA
G
 
Nucleotide Sequence: 426 bp     [Download]
>gi|58616422|ref|NC_006824.1|:13680-14105 Azoarcus sp. EbN1 plasmid 2, complete sequence
ATGCAAGTCGCAGTGCCCTCGTTCCGCCTCGATCGTAACGCCGTCTTCTATCTCGGCCTGCTCGCTCTTC
TGGCCTTCTTCCTGCTGGCGCCGCATTCGGCCTTCGCATCCGAAGGAACGGGCGGTTCGCTCCCGTATGA
GAGCTGGCTGACCAACCTGCGCAACTCCGTCACCGGTCCGGTCGCGTTCACGCTGGCCCTCATCGGCATC
GTCGTTGCTGGCGGCATCCTGATCTTCGGCGGAGAGCTCAACGGTTTCTTCCGCACCTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAAAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCGGCTGTCCCCGAGGACGCGATCCAGCACGCCAAGCTGGCCGCCTCGGTGGTCCTCCCCAAGCGGGCT
GGATAA
 Primer design