SecReT4
Protein ID: 58616438
T4SS name [ID]Trb [67]
Gene symboltrbG
Locus tagp2B6
StrainAromatoleum aromaticum EbN1
Repliconplasmid 2 [GenBank: NC_006824] [Browse all T4SS(s) in this replicon]
Location [Strand]17753..18649 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ5NWM1
KEGG IDeba:p2B6
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.7e-64, Aligned region: 70..296
Protein Sequence: 298 a.a.     [Download]
>gi|58616438|ref|YP_195567.1| mating pair formation protein TrbG [Aromatoleum aromaticum EbN1]
MKKHLSAVILGIALTASVVAAPDDDLADKYFSGKNPKLTAQEREALRIAKKWGANSATGIKPVAGANGAV
RFIYGAQQPSIVCAVLQVCDVALQPGELVNSIHLGDTARWTVEPAITGSGTAETQHLIIKPMDVGLETSL
IVTTNRRTYHLKLRSHRTEYMPQVAFTYPEDALAKWDAIRTREVREREEQAMPQTGEYLGDLSFDYDVSG
TTRWKPVRVYNDGRKTIIEMPSTMEQTEAPTLLVVRKDGGLFTDDETVLVNYRVQGDRYIVDTIFDKAVL
IAGVGSSQDRVTITRTGK
 
Nucleotide Sequence: 897 bp     [Download]
>gi|58616422|ref|NC_006824.1|:17753-18649 Azoarcus sp. EbN1 plasmid 2, complete sequence
ATGAAAAAACATCTTTCTGCTGTGATCCTGGGCATCGCGCTGACCGCATCCGTCGTGGCGGCACCAGACG
ATGACTTGGCCGACAAGTATTTCTCCGGGAAGAACCCCAAGCTGACCGCGCAAGAGCGGGAGGCGTTGAG
GATCGCCAAGAAGTGGGGGGCGAACTCGGCGACCGGTATCAAGCCGGTGGCCGGCGCTAACGGCGCCGTG
CGCTTCATCTACGGCGCACAGCAACCCAGCATCGTGTGCGCGGTACTCCAGGTCTGCGACGTAGCTTTGC
AGCCCGGCGAACTGGTGAACTCGATCCACCTGGGCGATACCGCCCGCTGGACGGTCGAGCCGGCGATCAC
GGGCAGCGGCACCGCCGAAACCCAGCACCTCATCATCAAGCCGATGGATGTCGGCCTGGAAACCAGCCTG
ATCGTGACTACGAACCGGCGCACCTATCACCTCAAGCTGCGCTCGCATCGCACCGAGTACATGCCGCAAG
TGGCCTTCACATACCCCGAGGACGCCCTTGCCAAGTGGGATGCGATCCGCACCCGCGAAGTGCGCGAGCG
CGAAGAGCAAGCGATGCCGCAGACCGGCGAATACCTCGGCGATTTGTCGTTCGACTATGACGTGTCGGGC
ACCACGCGCTGGAAGCCGGTGCGCGTCTACAACGATGGCCGCAAGACCATCATCGAAATGCCATCTACGA
TGGAGCAGACCGAGGCGCCGACCCTGCTGGTCGTGCGCAAGGATGGCGGGCTGTTCACCGACGACGAAAC
CGTGCTGGTCAATTACCGCGTCCAGGGCGACCGCTACATCGTGGACACGATCTTCGACAAGGCGGTCCTG
ATTGCCGGGGTCGGTAGCAGCCAAGACCGCGTGACCATCACCAGGACCGGGAAATGA
 Primer design