SecReT4
Protein ID: 58616443
T4SS name [ID]Trb [67]
Gene symboltrbL
Locus tagp2B11
StrainAromatoleum aromaticum EbN1
Repliconplasmid 2 [GenBank: NC_006824] [Browse all T4SS(s) in this replicon]
Location [Strand]21570..23216 [+]
ProductTrbL protein of DNA transfer system
Component typeTrbL
UniProt IDQ5NWL6
KEGG IDeba:p2B11
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.4e-41, Aligned region: 65..279
Protein Sequence: 548 a.a.     [Download]
>gi|58616443|ref|YP_195572.1| TrbL protein of DNA transfer system [Aromatoleum aromaticum EbN1]
MRLPVTFKALSMLLPLWLALFALDAHAAIDNADVLDSVLTRYQTAASGWAATIINSASWLFWLLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWLLTNGPNFAKSIMDSLRQIGGNATGLGIGLSPSGIVDV
GFEIFDKVIDQSSLWSPVNSAVGISIAAAILVILALVGVNMLLLLVSGWILAYAGIFFLGFGGSRWTSDM
AINYYKTVLGVAAQLLAMVLIVGIGKTFLDGYYGRMSESMTIKEMGVMLIVSVILLSLVNKLPSLVSGII
IGASVGHAGIGNFGAGAAVGAAGMAAAAAATGGAMLAVGAANAAGGAQAVMAAFSKASENVQSGADAFTS
MWAGGGPGGGGGSGKGEESTGSTPFAQAAGFASSGSVQALRGSSAARAEGQDWDAKGKEEGKSDQGQGKA
SESKANAGTGGAGKAEGGPQRSSGGLRPSAGKAGLFAADAAANLAKGTAQVAKEKMAGIRDAAMDRIAET
TGGKIAAAIKAGSAKDEAGSAIESMPTFGGNNLAGASTSDVDTAAEVAAFANRATKFV
 
Nucleotide Sequence: 1647 bp     [Download]
>gi|58616422|ref|NC_006824.1|:21570-23216 Azoarcus sp. EbN1 plasmid 2, complete sequence
ATGAGACTGCCAGTCACCTTCAAAGCCCTTTCTATGCTGTTGCCGCTGTGGCTGGCACTCTTTGCGCTGG
ATGCCCATGCCGCCATCGACAACGCGGACGTGCTCGATAGCGTACTGACGCGCTACCAGACAGCCGCGAG
CGGCTGGGCTGCCACCATCATCAATTCCGCGTCCTGGTTGTTCTGGCTGTTAGTCGTGATCTCGATGGTT
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGGGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTCACCGGCTTCTTCTGGTGGCTTTTGACCAACGGCCCGAACTTCGCCAAATCGATCATGGATAG
CTTGCGGCAGATCGGCGGCAATGCAACTGGACTCGGCATCGGCCTTTCCCCATCCGGGATCGTGGATGTG
GGTTTTGAGATCTTCGACAAGGTAATCGACCAATCGTCGCTGTGGTCGCCAGTGAATAGCGCCGTAGGGA
TCAGCATCGCCGCAGCCATCTTGGTGATTCTCGCTCTAGTCGGCGTCAACATGCTGCTACTGCTGGTCTC
CGGCTGGATTCTGGCGTATGCGGGAATCTTCTTCCTAGGCTTCGGCGGCTCCCGGTGGACCTCCGACATG
GCGATCAACTACTACAAGACCGTCCTCGGCGTGGCGGCTCAACTGCTCGCGATGGTGCTGATCGTCGGCA
TCGGTAAAACCTTCCTCGATGGCTACTACGGAAGGATGAGCGAAAGCATGACCATCAAGGAAATGGGGGT
CATGTTGATTGTTTCCGTAATCCTGCTATCGCTGGTCAACAAGCTCCCAAGCCTCGTATCCGGAATCATC
ATCGGCGCCAGTGTCGGGCACGCCGGCATTGGCAACTTCGGAGCTGGCGCTGCGGTCGGCGCCGCGGGCA
TGGCGGCAGCAGCAGCGGCGACGGGAGGCGCGATGTTGGCTGTAGGTGCCGCGAACGCGGCCGGTGGTGC
ACAAGCCGTGATGGCGGCCTTCTCCAAGGCCAGTGAGAACGTCCAATCCGGCGCTGACGCATTCACCAGC
ATGTGGGCCGGTGGCGGCCCGGGAGGGGGCGGAGGCAGCGGCAAGGGTGAGGAAAGCACCGGCAGCACGC
CATTCGCACAGGCGGCCGGCTTCGCATCATCCGGCAGCGTCCAAGCCCTACGCGGCAGTTCGGCAGCGAG
GGCCGAGGGGCAGGATTGGGACGCCAAGGGCAAAGAAGAAGGGAAGTCCGATCAGGGGCAAGGCAAGGCT
AGCGAGTCCAAGGCCAACGCAGGAACGGGCGGCGCCGGAAAGGCAGAAGGAGGGCCGCAGCGAAGCTCCG
GAGGCTTGAGGCCCTCGGCCGGGAAAGCGGGGCTGTTCGCCGCCGATGCAGCCGCGAACTTGGCGAAAGG
CACGGCACAGGTAGCAAAGGAAAAGATGGCGGGCATCAGGGATGCCGCGATGGATCGCATCGCCGAAACC
ACGGGGGGCAAGATCGCCGCCGCCATCAAGGCCGGGAGTGCAAAAGACGAGGCAGGAAGCGCCATCGAAT
CGATGCCGACGTTTGGAGGGAACAACCTCGCGGGCGCCAGCACCAGCGATGTCGACACGGCGGCAGAAGT
CGCTGCATTTGCCAACCGAGCCACCAAGTTCGTATGA
 Primer design