SecReT4
Protein ID: 58616621
T4SS name [ID]Trb [68]
Gene symboltrbB
Locus tagpA81_004
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]2457..3422 [+]
Productconjugal transfer ATPase TrbB
Component typeTrbB
UniProt IDQ5GRF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.5e-82, Aligned region: 27..295
FtsK_SpoIIIE [PF01580], Evalue: 5.4e-08, Aligned region: 143..195
AAA_10 [PF12846], Evalue: 9.6e-07, Aligned region: 150..198
AAA_19 [PF13245], Evalue: 1.2e-05, Aligned region: 145..189
AAA_29 [PF13555], Evalue: 1.9e-05, Aligned region: 143..171
AAA_16 [PF13191], Evalue: 3.7e-05, Aligned region: 144..177
DUF87 [PF01935], Evalue: 5.5e-05, Aligned region: 150..190
Protein Sequence: 321 a.a.     [Download]
>gi|58616621|ref|YP_195830.1| conjugal transfer ATPase TrbB [Achromobacter xylosoxidans A8]
MTEQKLEHNTIKERAKKKLERDMGPELLAALNDPKTVEIMLNADGIVWQEKLGEPMKCIGTLRFAQAQAM
IETIAGYHGKEVTRQRPILEGEFPLDGSRFAGQLPPVVPAPTFAIRKKAVAIFTQAQYVERGIMTAQQRD
SSIAAARAHRNILVIGGTGSGKTTLVNAIINEMVLQDPTERVFIIEDTGEIQCAAENYVQYHTSIDVTMT
ALLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNAKAGLDRLAMLISMHPDSPKPIEP
LIGEAVHVVVHIARTPDGSRRIQEILEVSGYANGQYATKTL
 
Nucleotide Sequence: 966 bp     [Download]
>gi|58616617|ref|NC_006830.1|:2457-3422 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGACCGAACAGAAGCTGGAACACAACACGATCAAGGAACGGGCGAAGAAGAAGCTCGAACGCGACATGG
GGCCGGAGCTGTTGGCAGCTCTGAACGATCCCAAGACCGTTGAAATCATGCTCAACGCGGACGGCATAGT
CTGGCAGGAGAAGCTGGGCGAGCCGATGAAGTGCATCGGCACCCTTCGCTTCGCGCAGGCCCAAGCCATG
ATCGAAACCATTGCCGGCTACCACGGCAAGGAAGTCACGCGGCAGCGGCCGATCCTGGAAGGCGAGTTCC
CGCTAGACGGTAGCCGCTTTGCCGGCCAGCTCCCCCCGGTCGTGCCCGCACCGACCTTTGCGATCCGCAA
GAAGGCGGTCGCCATCTTCACCCAGGCGCAGTACGTCGAGCGCGGAATCATGACCGCGCAGCAGCGCGAT
TCCTCGATTGCCGCCGCGCGTGCCCACCGGAACATCCTGGTGATCGGCGGCACCGGCTCGGGCAAGACCA
CGCTGGTGAACGCGATCATCAACGAGATGGTGCTTCAAGACCCGACCGAACGGGTTTTCATCATCGAGGA
CACCGGCGAAATCCAGTGCGCCGCCGAGAACTACGTCCAGTACCACACCAGCATCGACGTGACCATGACG
GCGCTGCTCAAGACCACGCTGCGCATGCGGCCCGACCGCATCCTGGTCGGCGAAGTGCGCGGCCCCGAAG
CACTTGATCTGTTGATGGCCTGGAACACCGGGCACGAAGGAGGAGCCGCAACCCTGCACGCAAACAACGC
CAAAGCGGGCCTTGATCGGCTCGCCATGCTCATCAGCATGCACCCCGATTCACCCAAACCCATTGAACCG
CTGATAGGCGAGGCGGTTCACGTGGTCGTTCATATCGCCCGCACCCCTGACGGCTCGCGGCGCATCCAGG
AAATCCTTGAGGTTTCCGGCTACGCCAACGGCCAGTACGCAACCAAAACCCTGTAA
 Primer design