SecReT4
Protein ID: 58616622
T4SS name [ID]Trb [68]
Gene symboltrbC
Locus tagpA81_005
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]3452..3916 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ5GRF3, E3HXM2
KEGG IDaxy:AXYL_06537
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-18, Aligned region: 17..110
Protein Sequence: 154 a.a.     [Download]
>gi|58616622|ref|YP_195831.1| conjugal transfer protein TrbC [Achromobacter xylosoxidans A8]
MQSTLPAFRFDSRAVFYLGMFALLAFFLLAPQHAFASEGTGGSLPYEGWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGVLHQAKVAALDMAGFPG
EAIARWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|58616617|ref|NC_006830.1|:3452-3916 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGCAATCGACCCTTCCCGCGTTCCGCTTCGACAGCCGCGCCGTGTTCTACCTGGGCATGTTCGCCCTCT
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCTTTCGCCTCCGAAGGCACCGGCGGTTCCCTGCCGTATGA
AGGCTGGTTGACCAACCTGCGCAACAGCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTTGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGTGCTGCACCAGGCCAAGGTCGCGGCGCTGGACATGGCCGGCTTCCCTGGT
GAAGCCATCGCACGCTGGGCCGAACGCGGCCACATCGCGGGGTAA
 Primer design