SecReT4
Protein ID: 58616623
T4SS name [ID]Trb [68]
Gene symboltrbD
Locus tagpA81_006
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]3920..4231 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDE3HXM3, Q5GRF2
KEGG IDaxy:AXYL_06538
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.9e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|58616623|ref|YP_195832.1| conjugal transfer protein TrbD [Achromobacter xylosoxidans A8]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFVLRLMAKSDPKL
RHVYLRHRRYKPYYPARSTPFRENTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|58616617|ref|NC_006830.1|:3920-4231 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGGCACTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGTGGCGACCGCG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGGGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGTTATTCGTGCTGCGCCTCATGGCGAAGTCCGACCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGAAA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design