SecReT4
Protein ID: 58616624
T4SS name [ID]Trb [68]
Gene symboltrbE
Locus tagpA81_007
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]4228..6786 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ5GRF1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.9e-53, Aligned region: 221..431
AAA_10 [PF12846], Evalue: 4.4e-30, Aligned region: 489..772
Protein Sequence: 852 a.a.     [Download]
>gi|58616624|ref|YP_195833.1| conjugal transfer protein TrbE [Achromobacter xylosoxidans A8]
MIEAIAMGIAVLGAVLWLILFARIRQVNAELKLKKHRSKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YQGDDNASSTEEQREMVSFRINQALAGLGSGWMVHVDAVRRPAPNYSERGVSTFTDPVSAAIDEERRRLF
EGLGTMYEGHFVFAVTWFPPVLAQRKFVELMFDDDAVTPDHTARTVGLIEQFKREIRDLESRMSSAVKLT
RLKGHKIATEEGREVTHDDFLSWLQFCVTGNYHPVQLPSNPMYLDAVIAGQELWGGVVPKIGRKFIQVVS
LEGFPLESTPGLLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSVNQD
AATMVADAEAAIAEVNSGLVAAGYFTSVVVLMDEDRERLAAAALSVEKPINRLAFAARIETINTMDAYLG
SLPGHGVENVRRPLIKTMNLADLLPTSSIWTGSATAPCPMYPPLAPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAAINAGSKGKTGLHFTVAADDDRLAFC
PLQFLETKADRAWAMEWIDTILALNGVDTTPGQRNEIGHAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERGLKGQPAVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTAALYRRMG
LNKRQIEILATAVPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESVAAIKSLQAKFGHEWVDHWLAG
RNLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|58616617|ref|NC_006830.1|:4228-6786 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGATCGAAGCAATCGCAATGGGCATTGCTGTACTCGGTGCGGTTCTGTGGCTCATCCTCTTTGCCCGTA
TCCGTCAGGTCAATGCCGAGCTGAAGCTCAAGAAGCATCGGTCGAAGGACGCGGGCCTGGCCGACTTGCT
CAACTATGCCGCCGTGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACCAAGGGGATGACAACGCCAGCAGCACCGAAGAGCAGCGGGAAATGGTGTCCTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGCAGCGGCTGGATGGTTCATGTCGATGCCGTGCGCCGGCCGGCACCCAACTACTC
CGAGCGCGGCGTCTCCACCTTCACCGATCCGGTGTCGGCCGCCATTGATGAAGAGCGCCGGCGGCTCTTC
GAGGGCTTGGGCACGATGTACGAAGGGCACTTCGTATTCGCCGTGACCTGGTTTCCGCCAGTGCTGGCCC
AGCGCAAGTTCGTTGAGCTGATGTTTGACGATGACGCGGTGACGCCCGACCACACGGCCCGCACCGTGGG
CCTCATCGAGCAGTTCAAGCGCGAAATCCGCGACCTGGAATCGCGCATGTCCTCGGCCGTCAAGCTCACG
CGCTTGAAGGGCCACAAGATCGCCACGGAAGAGGGCAGGGAAGTCACGCATGACGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACCGGCAACTATCACCCGGTGCAGCTCCCCAGCAACCCGATGTACTTGGACGCCGT
GATCGCCGGGCAAGAGCTGTGGGGCGGCGTCGTTCCGAAGATCGGCCGCAAGTTCATCCAGGTGGTGTCC
CTCGAAGGCTTCCCCTTGGAGTCAACGCCTGGCCTGCTGTCGGCCCTGGCCGAGCTGCCGAGTGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGACCAGGTTTTCAACACCAACACCGGCAGCGTCAACCAGGAC
GCGGCAACGATGGTGGCCGATGCCGAGGCGGCCATCGCCGAGGTCAATAGCGGCCTGGTGGCCGCCGGCT
ACTTCACGTCCGTGGTCGTGTTGATGGATGAGGATCGGGAGCGCCTGGCGGCCGCCGCGCTGTCGGTCGA
GAAGCCCATCAACCGGCTGGCCTTCGCGGCGCGCATCGAGACGATCAACACGATGGACGCCTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAAGACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCCATCTGGACGGGCAGCGCCACCGCGCCGTGCCCGATGTACCCGCCGCTGGCCCCGGC
GCTCATGCACTGCGTCACGGTCGGCGCTACGCCCTTCCGGCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCGGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGGC
GCTATGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCGCTCGCGGCCGCAATCAA
TGCCGGCTCGAAGGGCAAGACTGGCCTGCACTTCACGGTGGCCGCCGACGATGACCGCCTGGCCTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGCGGATCGGGCTTGGGCGATGGAGTGGATCGACACGATCCTTGCGC
TCAACGGCGTGGACACCACGCCAGGGCAGCGCAACGAGATCGGCCACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATCCAGGACGAAGCGATCCGCGAGGCCATCAAGCAA
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGATGCCGAAGAGGATGGCCTGTCGCTCTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTCGGCGAGAAGTTCGCGCTGCCGGTGCTGCTGTACCTGTT
CCGCCGCATCGAGCGCGGCCTTAAAGGCCAGCCGGCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCGGCGTTCCGCGCCAAGATTCGGGAATGGCTCAAGGTCTTGCGCAAGGCGAACTGCCTGGTGC
TCATGGCTACGCAAAGCCTTTCCGACGCGGCCAACTCGGGCATCTTGGATGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCGAACGTCTATGCCCGCGACGAGGACACGGCGGCGCTCTATCGCCGCATGGGC
CTCAACAAGCGGCAAATCGAAATCCTCGCCACGGCGGTTCCGAAGCGGCAGTACTACTACGTCTCCGAGA
ACGGCCGCCGCCTCTATGACCTCGCCCTGGGGCCGCTGGCCCTGGCCTTCGTCGGCGCGTCCGACAAGGA
ATCGGTCGCCGCCATCAAGAGCCTGCAAGCGAAGTTCGGCCATGAGTGGGTCGATCACTGGCTGGCCGGC
CGCAATCTGAATCTCAATGACTACCTGGAGGCCGCATGA
 Primer design