SecReT4
Protein ID: 58616625
T4SS name [ID]Trb [68]
Gene symboltrbF
Locus tagpA81_008
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]6783..7571 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDE3HXM5, Q5GRF0
KEGG IDaxy:AXYL_06540
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-56, Aligned region: 48..260
Protein Sequence: 262 a.a.     [Download]
>gi|58616625|ref|YP_195834.1| conjugal transfer protein TrbF [Achromobacter xylosoxidans A8]
MSFADTLKGLIFKKPATAAGRDKRDPRQTDEPLEGGRRQGEAENPYLAARRTWNDHVGGVVSSRQTWQVI
GILSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAASKADARVIHATVAEFITDARTVTP
DVALQRRSVFRVYAKLSPNDPATPKMNEWLNGTPDASPFRRAEKEMVNVEIKTAIPQTPDTWQVEWEETA
RDRQGTPKGKPAIWRALVTVYVAEVTPQTTDEQLRNNPLSVYVRDYSWSRVQ
 
Nucleotide Sequence: 789 bp     [Download]
>gi|58616617|ref|NC_006830.1|:6783-7571 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAGCTTTGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCACGGCCGCAGGACGCGACAAGC
GCGACCCTCGGCAGACCGATGAACCGCTGGAAGGCGGCCGACGCCAGGGCGAGGCCGAGAACCCCTATCT
GGCCGCTCGTCGCACCTGGAACGATCACGTGGGCGGCGTCGTGTCGTCTCGCCAGACCTGGCAAGTGATC
GGCATCTTGTCGCTGTTGATCGCGCTCGCCGGCGTCGGCGGCGTGATCCACATCGGCAGCCAGTCGAAGT
TCATCCCCTACGTGGTGGAAGTGGACAAGCTCGGCCAGACAGTGGCCGCCGGCCCGGTGCAAGCGGCCTC
GAAGGCCGATGCCCGCGTCATCCATGCGACGGTCGCCGAGTTCATCACCGACGCCCGCACGGTCACGCCG
GACGTGGCCTTGCAGCGCCGCTCTGTGTTCCGCGTGTACGCCAAGTTGTCGCCCAACGATCCGGCAACGC
CAAAGATGAATGAGTGGTTGAACGGCACCCCGGATGCCAGCCCGTTCCGTCGCGCTGAAAAGGAAATGGT
GAACGTCGAGATCAAGACGGCCATCCCGCAGACGCCGGACACCTGGCAAGTCGAGTGGGAAGAAACCGCC
CGCGACCGTCAAGGCACACCGAAGGGCAAGCCCGCGATCTGGCGTGCGCTGGTCACTGTGTACGTCGCGG
AAGTCACGCCGCAAACCACGGATGAGCAACTTCGGAACAACCCCCTAAGCGTGTACGTGCGGGACTACTC
CTGGTCGCGCGTTCAATGA
 Primer design