SecReT4
Protein ID: 58616626
T4SS name [ID]Trb [68]
Gene symboltrbG
Locus tagpA81_009
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]7568..8482 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ5GRE9, E3HXM6
KEGG IDaxy:AXYL_06541
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-64, Aligned region: 79..303
Protein Sequence: 304 a.a.     [Download]
>gi|58616626|ref|YP_195835.1| conjugal transfer protein TrbG [Achromobacter xylosoxidans A8]
MNPRTFTMKKIFSVVALGAALLSPTLALAADDLADKYFTGKNPTLTPQERAAIDIAKRWNAGAATGMKPV
AGSNGAIKFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGPNEVQHLIIKPMD
VGLETSLIVTTNRRAYHLRLRSHRTEYMPQVSFTYPEDALAKWDAIQRRETQERTDRTIPQTGEYLGDLK
FDYDLSGSASWKPVRVFNDGRKTIIEMPGTMEQTEAPTLLVVRREGGIFRDEETVMVNYRVQGNRYIVDT
VFDRAILIAGVGGSQDRVTISRRK
 
Nucleotide Sequence: 915 bp     [Download]
>gi|58616617|ref|NC_006830.1|:7568-8482 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAACCCAAGGACATTCACCATGAAGAAAATCTTTTCCGTTGTCGCCTTGGGCGCTGCGCTGCTGTCGC
CCACCCTGGCCCTGGCCGCCGATGACCTGGCCGACAAGTATTTCACCGGCAAGAACCCGACGCTGACGCC
TCAAGAGCGCGCGGCCATCGACATTGCGAAGCGATGGAACGCGGGCGCTGCCACCGGCATGAAGCCCGTC
GCCGGCTCCAATGGCGCGATCAAGTTCCTGTTCGGCGCGCAGCAGCCCAGCATCGTGTGCGCGGTGCTCC
AGGTGTGCGACGTGGCCTTGCAGCCAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGGTG
GACGGTCGAGCCGGCCATCACCGGCAGCGGCCCCAACGAAGTGCAGCACCTCATCATCAAGCCGATGGAT
GTTGGCCTGGAAACCAGCCTCATCGTGACGACGAACCGCCGCGCCTATCACCTGCGCCTGCGCTCGCATC
GCACCGAGTACATGCCGCAAGTCTCGTTCACCTACCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCCA
GCGCCGCGAAACGCAAGAACGCACCGACCGCACCATCCCGCAGACCGGCGAGTACCTGGGCGATCTCAAG
TTCGACTATGACCTGTCCGGCTCGGCGAGCTGGAAGCCGGTGCGTGTGTTCAACGATGGCCGCAAGACCA
TCATCGAAATGCCCGGAACGATGGAGCAAACCGAAGCGCCGACGCTCCTGGTCGTGCGCCGCGAGGGCGG
CATCTTCCGCGACGAGGAAACCGTGATGGTGAACTATCGCGTGCAGGGCAATCGCTACATCGTGGACACG
GTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGTGGAAGCCAAGACCGCGTGACTATCTCCCGGAGGA
AGTGA
 Primer design