SecReT4
Protein ID: 58616627
T4SS name [ID]Trb [68]
Gene symboltrbH
Locus tagpA81_010
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]8485..8946 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ5GRE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 2.9e-47, Aligned region: 32..153
Protein Sequence: 153 a.a.     [Download]
>gi|58616627|ref|YP_195836.1| conjugal transfer protein TrbH [Achromobacter xylosoxidans A8]
MRKIIFAALFVLALGGCATTGQYGNFVPPTATVDQQQLAREAWQQLAVLYPPAKTRLELQQATPDAFGQA
LVLTLRERGYALLEFNPASAKAQATAANEPASPAALPLRYVLDQAGDSNLYRLTLLVGHQSITRPYLVQD
GSFAPAGYWVRKE
 
Nucleotide Sequence: 462 bp     [Download]
>gi|58616617|ref|NC_006830.1|:8485-8946 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGCGCAAGATCATCTTTGCTGCGCTGTTCGTCCTCGCCCTGGGCGGCTGCGCGACCACCGGCCAATACG
GCAACTTCGTCCCGCCGACCGCAACGGTCGATCAGCAGCAGCTCGCCCGCGAAGCGTGGCAGCAGCTCGC
TGTGCTGTACCCGCCGGCCAAGACGCGCCTGGAGCTGCAACAGGCCACGCCTGATGCCTTCGGCCAGGCC
CTGGTGCTGACGTTGCGCGAGCGCGGCTATGCCCTACTGGAGTTCAACCCGGCCAGCGCGAAGGCGCAGG
CCACGGCGGCCAATGAGCCGGCATCGCCGGCGGCCCTGCCGCTGCGGTACGTGCTCGACCAAGCCGGCGA
CTCGAACCTGTACCGCCTGACTCTGTTGGTCGGCCATCAATCCATCACCCGCCCGTACCTGGTGCAAGAC
GGCAGCTTTGCGCCGGCTGGGTATTGGGTGCGCAAGGAGTGA
 Primer design