SecReT4
Protein ID: 58616628
T4SS name [ID]Trb [68]
Gene symboltrbI
Locus tagpA81_011
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]8950..10329 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ5GRE7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5e-64, Aligned region: 267..450
Protein Sequence: 459 a.a.     [Download]
>gi|58616628|ref|YP_195837.1| conjugal transfer protein TrbI [Achromobacter xylosoxidans A8]
MSDQADQMAPDASPGAVSKKSGVRRVNNMPMYILAAALGAFLLVMMLVAADRAAKQNAPAQGAAEKAGNT
SMFAKEIVGDRDGGTVEAASPLKPPELATGPEAAPVLVARPDLDAPPPPPSGNLGQPVHDDEADRIRMAK
LQMFQEAVKAKTGVRVDAPRSSGSSGAQPGTPQTRDEMLSRLAAVRQQIGAQASGDPTAAYQARLAQLRA
SGVGGQQAGGGVGGGAPQLLQTAGGGQGKNYAQFAGSGQGDRWRLDSQPEAPRSPFELRAGFVVPATLIS
GINSDLPGQIMAQVAQNVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQSRVLVAWQRIVFPDGKAMDIGTM
PGADSAGYAGFNDQVNNHYLRVFGSAFLMSGVIAAVSMQQDNSGSTGNQQRASDALSEALGQVLGNTIAQ
LVSKNLNIAPTLEIRPGYRFNVIVTKDMTFSKPYQSFDY
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|58616617|ref|NC_006830.1|:8950-10329 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAGTGACCAAGCCGATCAAATGGCACCGGACGCCTCGCCGGGCGCGGTATCGAAGAAGTCCGGCGTGC
GGCGTGTCAACAACATGCCGATGTACATCCTTGCGGCCGCGCTGGGTGCCTTCCTGCTGGTGATGATGCT
GGTCGCGGCGGATCGCGCTGCGAAGCAGAACGCACCGGCGCAAGGCGCGGCCGAGAAGGCGGGTAACACG
TCGATGTTCGCCAAGGAGATCGTCGGCGACAGGGATGGCGGCACGGTAGAAGCGGCCTCGCCGCTCAAGC
CGCCGGAGCTGGCGACCGGGCCAGAGGCTGCGCCGGTGCTTGTCGCGCGCCCCGACCTGGACGCGCCGCC
GCCACCGCCCAGCGGCAACCTGGGCCAGCCGGTGCATGACGATGAAGCCGACCGCATCCGCATGGCGAAG
CTGCAAATGTTCCAGGAAGCGGTCAAGGCCAAGACGGGCGTTCGTGTCGATGCGCCGCGCAGCAGCGGGT
CATCGGGCGCGCAGCCGGGCACGCCGCAGACGCGCGACGAAATGCTGTCCCGCCTGGCGGCTGTGCGGCA
GCAAATCGGTGCGCAAGCATCGGGCGATCCGACCGCCGCCTATCAGGCCCGGCTCGCGCAGCTTCGCGCC
TCGGGCGTCGGCGGCCAGCAGGCCGGCGGCGGCGTGGGTGGTGGTGCGCCGCAGCTCTTGCAAACCGCCG
GTGGCGGCCAGGGCAAGAACTACGCGCAGTTCGCGGGAAGCGGCCAGGGCGACCGTTGGCGGCTGGACTC
CCAGCCCGAAGCGCCGCGCTCGCCCTTCGAGCTGCGCGCCGGCTTCGTGGTGCCGGCCACGCTCATTTCG
GGCATCAACTCCGACTTGCCGGGCCAGATCATGGCCCAGGTCGCGCAGAACGTGTACGACACGCCGACCG
GCAAGCATCTGCTGATTCCGCAAGGCTCGCGCCTGGTCGGGTCGTATTCGAGCGATGTTGCCTACGGTCA
GTCGCGCGTGCTTGTGGCTTGGCAGCGCATCGTGTTCCCCGATGGCAAGGCGATGGACATTGGCACGATG
CCGGGCGCGGATAGCGCCGGGTACGCGGGCTTCAATGACCAGGTGAATAACCACTACCTGCGCGTGTTCG
GCTCGGCCTTCCTCATGTCGGGCGTCATCGCCGCCGTGAGCATGCAACAGGACAACAGCGGTTCCACCGG
CAATCAGCAGCGCGCCAGCGATGCTTTGAGCGAAGCACTTGGGCAAGTGCTGGGCAACACCATCGCCCAA
CTCGTTTCCAAGAATCTGAACATTGCCCCGACCTTGGAAATCCGCCCCGGCTATCGGTTCAACGTCATCG
TGACCAAGGACATGACGTTCTCGAAGCCGTACCAATCGTTTGACTACTAA
 Primer design