SecReT4
Protein ID: 58616629
T4SS name [ID]Trb [68]
Gene symboltrbJ
Locus tagpA81_012
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]10346..11119 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ5GRE6, E3HXM9
KEGG IDaxy:AXYL_06544
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|58616629|ref|YP_195838.1| conjugal transfer protein TrbJ [Achromobacter xylosoxidans A8]
MKQKFLAAKVALAVTLMAGSITTMSPAQAGIPVIDGGNLVQNVMTAIESVAQTLKQIEQYQTQLQQYENM
IQNTVAPAAYIWDQAQSTINGLMNAVDTLNYYKTQLGSIDSYLGKFQDVAYYRSSPCFNGTGGCTPAEQA
AMAENRRLASESQKKANDALFKGLDRQQDALKSDARQLERLQSAAQGANGQMQAIGFANQLAAQQANQLL
QIRGLMVAQQNAIATRMQVEADREAQQQAAGEALRKGEYRASPARNW
 
Nucleotide Sequence: 774 bp     [Download]
>gi|58616617|ref|NC_006830.1|:10346-11119 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAAGCAGAAGTTTTTAGCCGCTAAAGTCGCTCTCGCCGTCACTCTGATGGCCGGGTCGATCACCACCA
TGTCGCCCGCGCAGGCCGGCATTCCCGTCATCGACGGCGGGAACCTGGTGCAGAACGTCATGACGGCCAT
CGAGTCGGTGGCGCAGACGCTCAAGCAAATTGAGCAGTACCAAACCCAGCTCCAGCAGTACGAAAACATG
ATCCAGAACACGGTCGCGCCGGCGGCCTATATCTGGGATCAGGCGCAGTCCACGATCAACGGGCTGATGA
ATGCGGTCGATACGCTGAACTACTACAAGACCCAGCTCGGCAGCATCGACTCGTACCTGGGCAAGTTCCA
GGACGTGGCCTACTACCGCAGCTCGCCGTGCTTCAACGGCACCGGCGGCTGCACGCCCGCCGAACAGGCC
GCAATGGCCGAGAACCGCCGCCTGGCGAGCGAGAGCCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGCC
TGGATCGCCAGCAGGACGCCTTGAAGTCCGACGCGCGCCAGCTCGAACGGCTCCAGTCGGCCGCGCAGGG
CGCGAACGGGCAAATGCAGGCCATCGGCTTCGCCAACCAGCTCGCGGCCCAGCAGGCAAACCAGCTTCTG
CAAATCCGGGGCCTCATGGTCGCGCAGCAGAACGCCATCGCCACGCGGATGCAGGTCGAAGCCGACCGTG
AAGCGCAGCAGCAAGCCGCCGGCGAGGCGCTGCGCAAGGGCGAGTACAGGGCCAGTCCGGCCCGTAATTG
GTAA
 Primer design