SecReT4
Protein ID: 58616630
T4SS name [ID]Trb [68]
Gene symboltrbK
Locus tagpA81_013
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]11129..11350 [+]
Productentry exclusion protein TrbK
Component typeTrbK
UniProt IDE3HXN0, Q5GRE5
KEGG IDaxy:AXYL_06545
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|58616630|ref|YP_195839.1| entry exclusion protein TrbK [Achromobacter xylosoxidans A8]
MRLSKPSILAAAALVAALLAGCEKKPEPVTLPEVNAENCKPENIAKLDKSVQEAFSSQCLRAGSFKPSEP
KSW
 
Nucleotide Sequence: 222 bp     [Download]
>gi|58616617|ref|NC_006830.1|:11129-11350 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGCGCCTATCCAAACCCTCGATCCTGGCAGCGGCCGCCCTTGTGGCGGCCCTGCTGGCCGGCTGCGAGA
AAAAGCCCGAGCCGGTGACGCTGCCCGAAGTGAATGCCGAGAACTGCAAACCCGAGAACATCGCCAAGCT
CGATAAGAGCGTGCAAGAGGCGTTTTCATCGCAGTGCCTGCGGGCCGGCTCGTTCAAACCTAGCGAACCT
AAGTCCTGGTGA
 Primer design