SecReT4
Protein ID: 58616631
T4SS name [ID]Trb [68]
Gene symboltrbL
Locus tagpA81_014
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]11362..13080 [+]
Productmating pair formation protein TrbL
Component typeTrbL
UniProt IDQ5GRE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.8e-40, Aligned region: 64..278
Protein Sequence: 572 a.a.     [Download]
>gi|58616631|ref|YP_195840.1| mating pair formation protein TrbL [Achromobacter xylosoxidans A8]
MRMPASLKLALPLLVWLAFFSTDASAQMNSSGLFDDVLNRYNAAASGWAGVITNAASWLFWLLVTISMVW
TFGMMALRKADIGEFFAELVRFTIFTGFFWWLLTNGPNFASTIYASLRQIAGNATGLGQALSPSGIVDIG
FAIFYKVMDQSSVWSPVDSMAGILMAVAILIVLALIGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDMA
INYYKTVLGVAAQLMAMVLLVGIGKTFLDDYYARMSEGINLKEMGVMLIVCVILLALVNKIPALIAGVIT
GASVGGAGIGNFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSSGSDVMYML
GGGGGGDSGGGGGGEAGTSTPLGQAAGFGGGGGDSGGGGSSGGESKGGDKGGDKAGGDKAGSSSKGGEGG
GQKASGGGDAGGAKAGQGGGQGQGAGQGGQQDAPGSTGPGMLASAASALGKAGRVTADAGANLAKGVGAV
AAAKAASMRDSAMERIADTTGGKIAAAIKAQGGSSADTSIDVPDQQPSPTFGDNSLAGADSSADPESEVA
AFRDGGRNDKSA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|58616617|ref|NC_006830.1|:11362-13080 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAGAATGCCAGCCAGCTTGAAACTCGCCCTGCCGCTGCTCGTTTGGCTGGCGTTCTTTTCTACGGACG
CTTCCGCCCAAATGAACAGCTCGGGCCTCTTCGATGACGTTCTGAACCGCTACAACGCCGCCGCCAGCGG
CTGGGCCGGTGTCATCACCAACGCCGCATCCTGGTTGTTCTGGCTGCTGGTGACGATCTCGATGGTCTGG
ACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGGGAGTTCTTCGCGGAGCTTGTCCGCTTCACCA
TCTTCACCGGCTTCTTCTGGTGGTTGCTGACGAACGGCCCTAACTTCGCCTCGACCATCTATGCGTCGCT
ACGCCAAATTGCCGGCAACGCGACGGGCTTGGGTCAAGCCTTGTCGCCTTCCGGCATTGTCGATATTGGC
TTTGCCATCTTCTACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCATCC
TCATGGCCGTTGCCATCTTGATCGTGCTCGCGCTCATCGGCGTGAACATGCTTCTTCTCCTGGCGTCTGG
TTGGGTGCTCGCCTATGGCGGCGTGTTCTTCCTCGGCTTCGGTGGGTCGCGGTGGACTTCCGACATGGCG
ATCAACTACTACAAGACCGTGCTGGGTGTGGCCGCGCAGCTCATGGCAATGGTGCTGCTGGTCGGCATCG
GCAAGACCTTTCTGGATGACTACTACGCGCGCATGAGCGAGGGGATCAACCTCAAGGAAATGGGCGTGAT
GCTCATCGTCTGCGTGATCCTGCTGGCACTCGTCAACAAGATTCCGGCGCTCATCGCCGGCGTCATCACC
GGCGCGAGCGTGGGCGGTGCCGGCATCGGCAACTTCGGCGCAGGCGCGGCCCTCGGTGCCGCTGGCATGG
CGGCCGCAGCAGCGGCAACCGGCGGCGCTGCTCTGGCGGCCGGCGCGGCCTCGGCCGCCGGCGGTGCTTC
TGCGGTCATGGCCGCGTTCTCGAAGGCCAATGAAAACGTCTCGTCCGGGTCGGATGTCATGTACATGCTG
GGCGGTGGTGGTGGCGGCGACTCTGGCGGTGGTGGTGGCGGTGAAGCCGGCACCAGCACGCCCCTGGGCC
AAGCCGCCGGCTTCGGTGGCGGCGGTGGCGACTCTGGCGGCGGCGGCAGCAGCGGCGGCGAGTCGAAGGG
CGGCGACAAAGGCGGCGACAAGGCCGGCGGCGATAAGGCCGGCTCCAGCTCGAAGGGTGGCGAAGGCGGC
GGCCAGAAGGCCAGCGGCGGCGGTGACGCCGGCGGCGCGAAGGCCGGCCAGGGTGGCGGCCAGGGCCAGG
GAGCGGGGCAGGGCGGCCAGCAGGACGCACCTGGTAGTACCGGCCCCGGCATGCTGGCCTCGGCCGCTTC
CGCGCTTGGCAAGGCCGGCCGCGTCACGGCCGACGCCGGCGCGAACTTGGCGAAGGGTGTAGGTGCGGTG
GCGGCCGCGAAGGCCGCCAGCATGCGCGACTCGGCGATGGAACGCATCGCCGACACCACCGGCGGAAAGA
TCGCGGCCGCGATCAAGGCGCAGGGCGGCAGCTCGGCCGACACGAGCATCGACGTGCCCGATCAACAACC
CTCGCCGACCTTCGGCGACAACAGCCTGGCCGGAGCTGACAGCTCTGCCGATCCCGAGTCCGAAGTAGCC
GCGTTCCGTGACGGCGGCCGCAACGACAAATCTGCGTAA
 Primer design