SecReT4
Protein ID: 58616633
T4SS name [ID]Trb [68]
Gene symboltrbN
Locus tagpA81_016
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]13679..14314 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDE3HXN3, Q5GRE2
KEGG IDaxy:AXYL_06548
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|58616633|ref|YP_195842.1| conjugal transfer protein TrbN [Achromobacter xylosoxidans A8]
MPFAADLPPQLQERVVCAVSAAVKYEVPANIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLRDLA
RYGITADDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKAAKWADWLEA
RFVTLDVTKAGATPSMPTGPAPAVQAAQQATAAAPAAAPAARPAAAPSINVAGGYVPRSISFNNRSEGSP
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|58616617|ref|NC_006830.1|:13679-14314 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGCCCTTTGCTGCCGACCTTCCGCCGCAGCTCCAGGAGCGCGTCGTGTGCGCCGTTTCGGCGGCCGTGA
AGTACGAAGTGCCGGCCAACATCGTGTTGGCCGTCGCGGAGAAGGAAGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAACGGCACTCATGACGTGGGGCCGATGCAGTTCAACACGGCTTACCTGCGCGACCTGGCC
CGCTACGGCATCACGGCGGACGATGTAGCGGCCGCTGGCTGCTACTCGTTCGACCTCGCCGCCTGGCGCT
TGCGGATGCACATTCGCAACGACAAGGGCGATCTCTGGACGAAGGCCGCGAATTACCACTCACGCACGCC
GCAGTACAACGCGGTGTATCGCGCCGACCTGATGCGCAAGGCCGCCAAGTGGGCGGATTGGCTCGAAGCT
CGGTTCGTCACGCTGGACGTGACGAAGGCGGGGGCCACGCCCTCGATGCCGACCGGGCCAGCGCCGGCGG
TGCAAGCCGCCCAGCAGGCCACGGCAGCGGCCCCAGCGGCCGCGCCGGCGGCCAGGCCGGCAGCAGCTCC
ATCCATCAACGTCGCGGGCGGCTACGTGCCGCGCTCGATCTCCTTCAACAACAGAAGCGAAGGCTCGCCG
GAGTAG
 Primer design