SecReT4
Protein ID: 58616680
T4SS name [ID]Trb [68]
Gene symboltraF
Locus tagpA81_066
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]63261..63797 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDQ5GRA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 4.5e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|58616680|ref|YP_195889.1| conjugal transfer peptidase TraF [Achromobacter xylosoxidans A8]
MSRILKRITKGVAVAGLAALVLAAGSYAAGARINTTRSIPVGLYWTSSAPVEQGAYVLWCPPKVGVFDDA
KERGYMGAGFCPGDYGYMMKRVLAAKDDAVSVADDGVRVNGELLPHSKPIQADKSGRPLPRFQASTYTLG
NAELLLMSDVSDTSFDGRYFGPINRSQVQTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|58616617|ref|NC_006830.1|:c63797-63261 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAGCCGCATCCTGAAACGCATCACGAAAGGCGTAGCCGTCGCCGGCCTGGCCGCCCTGGTGCTGGCCG
CCGGCAGCTATGCCGCCGGTGCCCGCATCAACACCACCAGGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGCAGGGCGCTTACGTGCTTTGGTGCCCGCCGAAGGTCGGCGTGTTCGATGACGCC
AAGGAAAGGGGCTACATGGGGGCCGGGTTCTGCCCAGGCGACTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTATCGGTGGCCGATGACGGCGTGCGCGTCAATGGCGAGCTGCTGCCACATAG
CAAGCCCATCCAGGCCGACAAGTCCGGTCGGCCCTTGCCGCGCTTCCAGGCCAGCACCTACACGCTGGGC
AATGCCGAGCTGCTGCTTATGTCGGACGTGAGCGACACGTCTTTCGACGGCCGCTACTTCGGCCCGATCA
ATCGTTCTCAAGTTCAGACCGTGATCCGTCCGGTCATCACCTGGTGA
 Primer design