SecReT4
Protein ID: 58616681
T4SS name [ID]Trb [68]
Gene symboltraG
Locus tagpA81_067
StrainAchromobacter xylosoxidans A8 plasmid pA81 (NC_006830)
Repliconplasmid pA81 [GenBank: NC_006830] [Browse all T4SS(s) in this replicon]
Location [Strand]63794..65698 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ5GRA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.1e-163, Aligned region: 121..618
TraG-D_C [PF12696], Evalue: 2.6e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.2e-26, Aligned region: 176..568
Protein Sequence: 634 a.a.     [Download]
>gi|58616681|ref|YP_195890.1| conjugal transfer coupling protein TraG [Achromobacter xylosoxidans A8]
MKIKMNTAVGPQFRSAKPKTPKLLPILGGVSLVGGLQAATQFFAYTFQYHASLGANLGHVYAPWSILNWS
AKWYSQYPDEIMRAGSIGMVTATVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKDAPTATGVYVGGWQDKDGNFYYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASSSGGVCWNPLDEIRVGTEAEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKARNDGGTATLPSVDAMLADPNRDIGELWMEMTTYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKDLMHSDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFENGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLRSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNDKGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFQARASIPAPKATDRLRQVVEAGE
GITI
 
Nucleotide Sequence: 1905 bp     [Download]
>gi|58616617|ref|NC_006830.1|:c65698-63794 Achromobacter xylosoxidans A8 plasmid pA81, complete sequence
ATGAAAATCAAGATGAACACCGCCGTGGGGCCGCAGTTTCGCAGCGCGAAGCCAAAGACCCCCAAGCTCT
TGCCGATCCTCGGCGGGGTATCCCTGGTCGGCGGCCTCCAGGCCGCGACACAGTTCTTCGCCTACACGTT
CCAGTATCACGCGAGCCTCGGGGCCAACCTCGGGCACGTGTACGCGCCCTGGTCGATCCTGAACTGGTCG
GCGAAGTGGTACAGCCAGTACCCCGACGAGATCATGCGGGCCGGCAGCATCGGCATGGTGACTGCCACCG
TGGGCCTGCTGGGTGTGGCCGTGGCGAAAGTCGTCACGTCCAACAGCTCGAAGGCGAACGAATACCTGCA
CGGTTCGGCCCGCTGGGCCGAAAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCGCGCGAGCGGAACGTC
CTGGAGATCGTGACCGGCAAGGACGCACCCACCGCCACCGGCGTCTATGTCGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTACTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCGACGCGAAGCGG
CAAGGGCGTCGGCCTGGTGGTGCCGACGCTGCTTTCGTGGGGCGCAAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCGCTGACCGCCGGCTGGCGGCAGAAGCACGCGAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCAGCTCGGGCGGCGTGTGCTGGAACCCGCTGGACGAAATCCGCGTCGGCACCGAGGCCGAAGT
CGGCGACGTGCAGAACCTAGCAACTTTGATAGTTGACCCGGACGGCAAGGGCCTGGATTCCCACTGGCAA
AAGACCGCCTTCGCGCTCCTGGTCGGCGTCATCCTGCACGCGCTCTACAAGGCCAGGAACGACGGCGGCA
CGGCCACGCTGCCATCGGTCGATGCCATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTATGGATGGA
AATGACCACCTACGGGCACGTGGACGGTCAGAACCACCACGCCATCGGATCGGCCGCCCGCGACATGATG
GATCGGCCAGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAATCCTATTTGGCCCTGTACCGCGATC
CAGTGGTGGCGCGCAACGTGAGCCGGTCGGACTTCCGCATCAAAGACCTGATGCACTCCGACGACCCGGT
GAGCCTGTACATCGTCACGCAGCCCAACGACAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGAACGGCCGGCCGGTGGCCCACTACAAGCACC
GGCTGCTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTCGAAATCATGCAAGAGTCGCTGGCCTT
CGTCGCCGGCTACGGCATCAAGTGCTACCTGATTTGCCAGGACATTAACCAGCTCCGAAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACAGCCGAACACCTGTCCCGACTGACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACCTACCAGGAAGTGCAGCGCCCCTTGCTGACG
CCCGATGAATGCCTGCGGATGCCGGGGCCGAAGAAGAACGACAAGGGCGAGATCGAGGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCCGCCATCTACGGCAAGCAGCCGCTGTACTTCAAAGACCCGGTGTT
TCAGGCGCGGGCCTCGATCCCCGCGCCGAAGGCCACCGACCGGCTGCGCCAGGTTGTCGAGGCAGGGGAG
GGCATCACGATATGA
 Primer design