SecReT4
Protein ID: 58616740
T4SS name [ID]VirB [505]
Gene symbolvirD4
Locus tagERGA_CDS_00130
StrainEhrlichia ruminantium str. Gardel
Repliconchromosome [GenBank: NC_006831] [Browse all T4SS(s) in this replicon]
Location [Strand]12170..14572 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDQ5FF33
KEGG IDerg:ERGA_CDS_00130
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.1e-153, Aligned region: 125..569
TraG-D_C [PF12696], Evalue: 7.1e-27, Aligned region: 408..530
TrwB_AAD_bind [PF10412], Evalue: 7.2e-26, Aligned region: 241..544
Protein Sequence: 800 a.a.     [Download]
>gi|58616740|ref|YP_195939.1| type IV secretion system component VirD4 [Ehrlichia ruminantium str. Gardel]
MDSTSANHIRNILFLFLGAFFGLEFCFYLSGVLFILMVWGPDYLDFNTINPSFHDFPDRIWPTIFTYIEH
WWHNPSLYDAVLLSKLAFSLIIPIGIFSAILWNLRNILFDWRPFKKKESLHGDSRWATEKDIRKIGLRSR
KGILLGKDKRGYLIADGFQHALLFAPTGSGKGVGFVIPNLLFWEDSVVVHDIKLENYELTSGWRKKRGQE
VFVWNPAQPDGISHCYNPLDWISSKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVK
SFGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTA
TASSDFNIQDFKRKKVTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRNLPSDDEPYGVLFLMDEFPTLGK
MEQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTV
NQESLNRPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDEQILLIESTYPIKSKKIKYFEDKNFTKKL
LKSTFVPTQEPYDPNNIKPTYKENENTIPSLEGNIPAKTDNQEHSMYESIEEEPDNYDDDFDFDDLDEYT
DEDYNQEFDDENYDQHDDMYNHKLDTYKEDIDEDEDEDEDEEDDESNEEDVYDDYRYQNEYHKNIDNTES
DTNEINMEYDHNIDQSEDQHHEQYNRNTDHINEGTNDYDDLDHQYEDEDNKESNEDEENNNHISQNDYLY
ENNDVEEDIKQTDNKKPKKKNTSKKKNAKQ
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|58616727|ref|NC_006831.1|:c14572-12170 Ehrlichia ruminantium str. Gardel, complete genome
ATGGATAGTACAAGCGCAAATCATATTCGCAATATTTTATTTCTATTTCTAGGTGCATTCTTTGGACTAG
AATTTTGTTTCTATTTATCAGGTGTACTATTTATTCTAATGGTATGGGGACCAGATTATTTAGATTTTAA
CACAATAAATCCTAGTTTTCATGATTTTCCAGATAGAATTTGGCCTACAATTTTTACATATATAGAACAC
TGGTGGCACAATCCTTCACTATATGATGCAGTATTGTTATCAAAATTAGCATTTTCTTTAATAATACCAA
TAGGTATTTTCAGTGCTATATTATGGAACTTACGGAATATATTATTCGACTGGAGACCATTTAAGAAAAA
AGAATCTCTACATGGTGACTCAAGATGGGCAACAGAAAAAGATATACGTAAAATAGGTTTACGTAGTAGA
AAAGGTATACTATTAGGAAAAGATAAGAGAGGATACTTAATTGCTGACGGTTTTCAACATGCATTATTGT
TTGCACCAACAGGTTCTGGAAAAGGTGTAGGATTTGTAATACCCAACTTATTGTTTTGGGAAGATTCTGT
AGTAGTACATGACATAAAATTAGAGAACTATGAGTTAACAAGCGGATGGAGAAAGAAAAGAGGACAAGAA
GTTTTCGTATGGAATCCAGCACAACCAGATGGAATAAGTCATTGCTATAATCCTTTAGATTGGATAAGTT
CTAAACCTGGACAAATGGTAGATGATGTACAAAAAATTGCTAACTTAATAATGCCAGAACAAGATTTTTG
GTACAATGAAGCACGTAGTTTATTTGTTGGAGTAGTTTTATATCTACTTGCAGTACCAGAAAAAGTAAAA
TCTTTTGGAGAAGTTGTACGTACAATGCGTAGCGACGATGTTGTATATAACTTAGCAGTAGTACTAGACA
CAATAGGAAAAAAAATTCACCCAGTTGCGTACATGAACATAGCTGCATTCTTACAAAAAGCTGATAAAGA
ACGTTCAGGCGTAGTATCAACAATGAACTCATCTCTAGAACTATGGGCAAATCCATTAATAGACACAGCT
ACAGCATCTAGTGATTTCAATATTCAAGATTTTAAAAGAAAAAAAGTTACAGTATATGTTGGATTAACAC
CAGATAATCTAACTCGTCTCAGACCTTTAATGCAAGTTTTTTATCAACAAGCTACCGAATTTTTATGTAG
AAATTTACCATCAGATGACGAACCGTATGGTGTATTATTCTTAATGGACGAGTTTCCAACACTTGGAAAA
ATGGAGCAATTTCAAACTGGTATTGCATATTTCCGTGGATATAGGGTAAGATTATTTTTAATAATTCAAG
ATACAGAACAGCTCAAAGGTATATACGAAGAAGCAGGAATGAATTCATTCTTATCAAACTCCACTTACAG
AATTACTTTTGCAGCAAATAATATTGAAACTGCAAACTTAATATCACAACTTATAGGAAATAAAACTGTT
AATCAAGAATCTTTAAACAGACCAAAATTCTTAGATCTCAATCCAGCATCTCGTTCATTACATATATCAG
AAACACAAAGAGCACTGTTATTACCACAAGAAGTAATAATGTTACCTAGAGATGAACAAATACTGTTAAT
AGAGTCTACTTATCCTATAAAGTCGAAAAAGATAAAATATTTCGAAGACAAAAACTTTACAAAAAAATTA
TTAAAAAGTACTTTTGTTCCTACTCAAGAACCTTACGATCCTAATAACATAAAACCAACATATAAAGAAA
ATGAAAATACTATACCAAGCCTTGAAGGTAATATTCCTGCTAAAACTGATAACCAAGAACATAGTATGTA
TGAGAGCATAGAAGAAGAACCCGATAATTATGATGATGATTTTGATTTTGATGATTTAGATGAATACACA
GATGAAGATTATAATCAAGAGTTCGATGATGAAAATTATGACCAACATGATGATATGTATAACCATAAGT
TAGATACATACAAAGAAGACATTGATGAAGATGAAGATGAAGATGAAGACGAAGAAGATGATGAAAGTAA
TGAAGAAGATGTATATGATGATTACCGATACCAAAATGAGTATCATAAGAATATAGACAACACTGAAAGT
GATACAAATGAAATTAATATGGAATATGATCACAATATAGATCAAAGTGAAGACCAACATCATGAACAAT
ACAACAGAAATACTGATCACATAAATGAAGGTACAAATGATTATGATGACCTAGATCATCAATATGAAGA
CGAAGACAACAAGGAAAGTAATGAGGATGAAGAAAATAATAATCACATAAGTCAAAATGATTATCTTTAT
GAAAATAATGACGTTGAGGAAGATATAAAGCAAACTGATAACAAAAAACCAAAAAAGAAAAATACTAGTA
AGAAGAAGAATGCTAAACAATAA
 Primer design