SecReT4
Protein ID: 58616741
T4SS name [ID]VirB [505]
Gene symbolvirB11
Locus tagERGA_CDS_00140
StrainEhrlichia ruminantium str. Gardel
Repliconchromosome [GenBank: NC_006831] [Browse all T4SS(s) in this replicon]
Location [Strand]14613..15611 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ5FF32
KEGG IDerg:ERGA_CDS_00140
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.6e-90, Aligned region: 12..311
Protein Sequence: 332 a.a.     [Download]
>gi|58616741|ref|YP_195940.1| type IV secretion system ATPase VirB11 [Ehrlichia ruminantium str. Gardel]
MTTSYAALNTYLEPLQAIFQEEGVNEISINQECEVWIENRGNIRCESIPVLNLSHLKALGRLIAQATEQK
ISEENPLLSATLPNGYRIQIVFPPACEATAVAMSIRKPSAMQLSLDDYEKMGAFDQAITENQQNTVDIEL
NKLLKQKKIKDFLEYAILHKKNIIISGGTSTGKTTFTNAALRTIPKDERLITVEDAREIVLNNHPNRVHL
ITSKGGQGRAKVSIQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPMMALEQLK
LMVMQAGLGIPPDQIINYITNIVDIVIQLKRGSSGVRYVSEILFTKSLQKND
 
Nucleotide Sequence: 999 bp     [Download]
>gi|58616727|ref|NC_006831.1|:c15611-14613 Ehrlichia ruminantium str. Gardel, complete genome
ATGACAACAAGTTATGCAGCTTTAAATACATATCTTGAACCATTACAGGCTATCTTTCAGGAAGAAGGAG
TAAATGAAATATCTATAAACCAAGAGTGTGAGGTGTGGATAGAAAATCGAGGAAATATACGTTGTGAATC
TATACCAGTTCTCAATCTATCACACCTAAAAGCATTAGGAAGATTAATTGCCCAGGCTACAGAACAAAAA
ATAAGTGAGGAAAATCCCCTATTATCAGCAACATTACCTAATGGCTATCGTATACAGATAGTTTTTCCTC
CAGCATGTGAAGCAACTGCAGTTGCTATGTCAATAAGGAAACCATCAGCTATGCAGCTTTCCTTAGATGA
CTATGAAAAAATGGGAGCATTTGACCAAGCCATAACAGAAAATCAACAGAATACCGTAGATATTGAACTC
AATAAATTATTAAAACAAAAAAAAATCAAAGACTTTTTAGAGTATGCAATATTACATAAGAAAAACATAA
TAATAAGTGGTGGTACATCAACGGGAAAAACAACTTTTACTAATGCGGCATTACGTACCATACCAAAGGA
TGAAAGGTTAATTACAGTAGAGGATGCAAGAGAAATTGTTTTAAATAATCATCCAAATCGAGTACATCTT
ATAACATCCAAAGGAGGGCAAGGTAGAGCTAAAGTAAGTATTCAAGATCTAATAGAAGCATGCTTAAGGT
TACGTCCAGATAGAATAATAGTTGGAGAGCTACGTGGAGCAGAAGCTTTTAGTTTCCTAAGAGCAATTAA
TACAGGACACCCTGGATCAATATCTACTCTACATGCTGATACACCAATGATGGCTCTTGAACAATTAAAA
CTTATGGTTATGCAAGCAGGTCTTGGTATTCCTCCTGATCAAATTATCAATTATATAACCAATATAGTTG
ATATTGTAATACAATTAAAACGTGGATCATCTGGTGTAAGATATGTATCAGAAATACTGTTCACTAAATC
TTTACAGAAAAATGATTAA
 Primer design