SecReT4
Protein ID: 58616744
T4SS name [ID]VirB [505]
Gene symbol-
Locus tagERGA_CDS_00170
StrainEhrlichia ruminantium str. Gardel
Repliconchromosome [GenBank: NC_006831] [Browse all T4SS(s) in this replicon]
Location [Strand]17783..18481 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDQ5FF29
KEGG IDerg:ERGA_CDS_00170
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-50, Aligned region: 23..230
Protein Sequence: 232 a.a.     [Download]
>gi|58616744|ref|YP_195943.1| hypothetical protein ERGA_CDS_00170 [Ehrlichia ruminantium str. Gardel]
MFKFGKKNKVSKSSSIPQSENLAHSWHVSRYSSILIQRNILLFLTMLALCTVGVSVFVISNISKSRTIEP
FVVEIEKKSGITTLVNPISVKQYSADEVLNNYFIIEYVRSRELFDPNNFQYNYYTKVRLLSDQTTYAEFR
RWTRLSNPASPLNLYANVTSGILKIRSLQHLRPGNVQIRFSLEFNTPNGVVKKDRIATLSFQYATLEMNE
QERQVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|58616727|ref|NC_006831.1|:c18481-17783 Ehrlichia ruminantium str. Gardel, complete genome
ATGTTTAAATTTGGAAAAAAGAATAAGGTAAGTAAGAGTAGTAGTATACCACAGAGTGAAAACTTGGCAC
ATAGCTGGCATGTAAGTCGCTACAGTTCCATTCTTATACAAAGAAATATACTATTATTTCTTACTATGTT
AGCATTGTGTACAGTAGGAGTTAGCGTTTTTGTAATTTCTAACATAAGTAAAAGTAGAACTATAGAACCA
TTTGTAGTAGAAATAGAAAAAAAATCTGGTATTACTACATTAGTTAATCCAATCTCAGTAAAACAATACT
CAGCAGATGAAGTTTTAAACAATTATTTTATAATAGAGTATGTAAGATCAAGAGAACTTTTCGATCCTAA
TAATTTTCAATATAATTATTATACAAAGGTTCGTTTGCTATCTGATCAAACAACATATGCAGAATTTCGT
AGATGGACAAGATTAAGCAATCCTGCAAGTCCTTTAAACTTATATGCAAATGTAACTTCAGGTATTTTAA
AAATTAGATCATTACAACACTTACGTCCAGGAAATGTACAAATAAGGTTCTCTTTAGAGTTCAATACCCC
AAATGGGGTAGTGAAAAAAGATAGGATAGCTACTTTGTCATTCCAATATGCAACTCTCGAAATGAATGAG
CAAGAACGTCAAGTCAATCCTTTAGGATTTCAAATAACTTACTATAGGGCAGATGATGAATTTTTATAA
 Primer design