SecReT4
Protein ID: 59714394
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0038
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]25673..25981 [+]
Productattachment mediating protein VirB2-like protein
Component typeVirB2
UniProt IDQ5DY66
KEGG IDvfi:VF_B0038
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.5e-19, Aligned region: 5..100
Protein Sequence: 102 a.a.     [Download]
>gi|59714394|ref|YP_207168.1| attachment mediating protein VirB2-like protein [Vibrio fischeri ES114]
MNTTVSYTSSRPLFIILCLVVLVFALFPELAHASGGLNKVNDFMEDLAKILRGASIVTVTVALMWIGYKY
QFTDWDIREFGRILMGALLIGGAAEIARYFVS
 
Nucleotide Sequence: 309 bp     [Download]
>gi|59714356|ref|NC_006842.1|:25673-25981 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGAACACGACAGTTTCATACACTTCATCACGGCCATTATTTATCATTTTATGTTTAGTAGTGTTGGTTT
TTGCTCTTTTCCCTGAGTTAGCTCATGCTTCTGGTGGATTAAACAAAGTTAATGATTTTATGGAAGACTT
AGCGAAAATTTTACGTGGTGCGTCCATCGTGACTGTAACCGTAGCCCTTATGTGGATAGGTTATAAATAT
CAATTCACTGATTGGGATATTCGAGAGTTTGGAAGAATACTCATGGGTGCGCTGTTAATCGGTGGTGCTG
CTGAGATTGCTCGTTACTTTGTATCATAA
 Primer design