SecReT4
Protein ID: 59714395
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0039
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]26299..28752 [+]
ProductVirB4 ATPase
Component typeVirB4
UniProt IDQ5DY65
KEGG IDvfi:VF_B0039
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.1e-41, Aligned region: 177..374
AAA_10 [PF12846], Evalue: 2.3e-28, Aligned region: 437..724
Protein Sequence: 817 a.a.     [Download]
>gi|59714395|ref|YP_207169.1| VirB4 ATPase [Vibrio fischeri ES114]
MKPTKYATAINQEVSLAHYIPYSSHLTDSILITTDGDLLQMFRLSGVAFETKDNEELSLLHQRLNTLYKG
LSESDVSLWTHVIRRKVKHTINGEFNQHFAAHFDAVYNAQFGEEIMTNEFYVTVIQRSTDRLKKLNRNID
AIKARLVERIDAFTEVTDLIKNNLESYHPTSLTCKTNQQGTVLSEPLTVLNYLLTHEWVNVHKPTGEIKH
AIGNAWIKIGSDTIELNSVSSTHYAQGIDIKEYASRSYNGLLNGLLYSEFEFVLTQSFSLYPRKIAAKFI
KTQKRRGKSSGDGAITQIQDLDQASNDLLDGHFAMGEYHFSLLVFGDSIDNVRQYRSEAQKSLSHSELLC
VPIKIATDAAFFAQLPANWGYRPRVVGLTSRNFASFSPFHNFLIGKKEGNPWGDAVTRLKTLSGHPFYFN
FHYTLTGDDNFNEKVAGNTRMIGMTGTGKTVALGLLYCQAQKYAQHSPFSTVFFDKDRGAEVMIRALGGN
YLRVQNGKQTGFNPLQMNPTPQNISFLKRWVRQLVESKQHPLTTLDERSISQAVDTVMRMEKPLRRLTLI
NQNIAVGTSKEERENSIKARLDKWCQGGEFAWVFDNDVDLLDFNSATNIGIDGTEFLDNHDIRTPICLYL
LHRMDEVIDGRRFFYVMDEAWKWVNDDAFSDFVGNKQLTIRKQNGFGVFATQLPSSLLGSPQGAALIESC
STEIYLPNPKAKHDEYVTDLGLSEKEFSILKEFGEKSRLCLIKQGNQSAICSLTMPGMSNELTLLSASSD
ELPLFDESIKEVGENPIDWIPIFLQKVREEKERKQGVRNEQHHPIVS
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|59714356|ref|NC_006842.1|:26299-28752 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGAAACCCACAAAATACGCAACGGCCATCAATCAAGAAGTATCACTTGCACACTACATCCCATACTCAA
GTCATTTAACTGATTCGATATTGATCACCACCGATGGTGATTTGCTGCAAATGTTCCGACTCAGTGGTGT
TGCTTTTGAAACAAAAGACAATGAAGAATTATCATTGTTACACCAACGCCTCAACACGCTATATAAAGGC
TTATCAGAATCCGATGTCAGTTTATGGACTCACGTCATCCGTCGTAAAGTAAAACACACCATTAACGGTG
AGTTTAACCAACACTTTGCAGCGCATTTTGATGCGGTATATAACGCGCAGTTTGGCGAAGAAATCATGAC
CAATGAGTTTTACGTCACGGTCATACAGCGTTCAACCGATAGACTCAAAAAGCTCAATCGTAATATTGAC
GCGATTAAAGCACGTTTAGTTGAGCGTATTGATGCTTTTACTGAAGTGACCGATTTAATAAAAAATAACT
TAGAAAGTTATCATCCAACATCACTGACCTGTAAAACCAATCAGCAAGGTACTGTTCTCTCTGAGCCATT
AACCGTATTAAATTACTTATTGACCCACGAATGGGTCAACGTTCATAAACCAACGGGCGAAATTAAACAC
GCCATTGGTAATGCTTGGATAAAAATTGGCTCAGATACCATTGAGCTAAACTCAGTATCTAGTACGCATT
ATGCACAAGGGATCGATATTAAAGAGTACGCTTCTCGCTCTTATAACGGATTGCTCAACGGATTACTTTA
TAGTGAGTTTGAATTTGTGCTCACTCAATCCTTTAGCTTATATCCACGAAAGATAGCTGCAAAGTTCATT
AAGACTCAAAAAAGAAGAGGCAAAAGCTCAGGGGATGGAGCGATTACTCAGATACAAGATTTAGATCAAG
CATCAAATGATTTACTCGATGGTCACTTTGCAATGGGGGAATATCATTTCTCATTACTTGTGTTTGGTGA
TTCCATTGATAACGTTCGTCAATATCGTAGTGAAGCTCAAAAAAGTTTATCTCACTCAGAGTTACTTTGT
GTTCCAATCAAAATCGCTACCGATGCGGCGTTCTTTGCTCAACTCCCTGCCAATTGGGGGTATCGTCCTC
GCGTGGTTGGTCTAACGAGCCGAAACTTCGCCAGTTTCTCACCTTTCCACAATTTTTTAATTGGGAAAAA
AGAAGGGAATCCTTGGGGCGATGCGGTCACTCGTTTAAAAACCCTATCGGGACACCCTTTCTATTTTAAT
TTTCATTACACCCTCACAGGTGATGATAATTTTAATGAAAAAGTGGCTGGTAACACCCGAATGATAGGCA
TGACAGGAACGGGAAAAACCGTTGCTCTTGGCCTACTCTATTGCCAAGCTCAAAAATACGCACAACACAG
CCCGTTTAGTACGGTATTTTTTGATAAAGATCGTGGTGCAGAAGTCATGATACGAGCACTTGGTGGTAAC
TACCTACGAGTGCAAAATGGCAAACAAACAGGGTTTAACCCTCTTCAGATGAACCCAACCCCACAGAATA
TTTCGTTTCTAAAACGTTGGGTTCGCCAGTTAGTAGAGTCAAAACAACATCCTCTAACAACGTTAGATGA
ACGCAGTATCAGCCAAGCGGTAGACACCGTAATGAGAATGGAAAAACCATTACGTCGATTAACCTTAATT
AATCAAAACATTGCGGTTGGAACCAGCAAAGAAGAGAGAGAAAACAGCATAAAAGCGCGGTTAGATAAAT
GGTGTCAAGGCGGTGAATTTGCATGGGTGTTCGATAATGATGTAGATCTACTCGATTTCAATTCAGCAAC
CAACATCGGCATCGATGGCACTGAGTTTCTTGATAATCACGATATTCGTACTCCCATTTGTTTATACCTA
CTGCATAGAATGGATGAAGTCATTGATGGCCGTCGATTCTTTTATGTCATGGATGAAGCGTGGAAATGGG
TTAACGATGACGCTTTTTCTGACTTTGTCGGAAACAAACAACTGACGATACGAAAACAAAATGGGTTTGG
TGTCTTTGCGACACAATTACCCTCTTCTCTGCTTGGCTCACCTCAAGGTGCAGCGTTAATCGAATCATGC
TCAACTGAGATTTATTTACCGAATCCAAAAGCAAAGCATGACGAATACGTAACTGACCTTGGATTATCTG
AAAAAGAGTTTTCTATCCTAAAAGAGTTTGGAGAAAAAAGCCGTTTATGCCTGATAAAACAAGGCAATCA
ATCAGCTATCTGCTCACTCACAATGCCTGGTATGAGTAATGAATTAACTCTCCTTTCTGCAAGCTCTGAC
GAGCTGCCTCTCTTTGATGAATCAATCAAAGAAGTGGGAGAAAATCCTATCGATTGGATCCCAATTTTTC
TGCAAAAAGTTCGAGAAGAAAAAGAACGTAAACAAGGAGTTCGTAATGAACAACATCACCCTATTGTGTC
TTAG
 Primer design