SecReT4
Protein ID: 59714396
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0040
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]28836..29516 [+]
Productchannel protein VirB8
Component typeVirB8
UniProt IDQ5DY64
KEGG IDvfi:VF_B0040
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-56, Aligned region: 16..223
Protein Sequence: 226 a.a.     [Download]
>gi|59714396|ref|YP_207170.1| channel protein VirB8 [Vibrio fischeri ES114]
MLNKKEQAALFEGSEALDFEASKMLMVAKSENRAWNIAKGACALTFLSWLALIFLMPLKTVVPYVAMVNE
TTGHTQLLTTITEETISKQDALDAYWVAYYVRNHETYDWYTIQDSYDNTLLLSSDEVGRDYAGLFEGNNA
LDSVWGKRVKAQVRLLSKPIIKNNIATVRFEKTIKSVDDTGKGQPTVWIATLAYQYKSDPLTEEERLKNP
LGFQVVSYRLDPELME
 
Nucleotide Sequence: 681 bp     [Download]
>gi|59714356|ref|NC_006842.1|:28836-29516 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGCTCAATAAAAAAGAACAAGCCGCTTTATTTGAAGGCTCTGAGGCTCTGGATTTTGAAGCATCAAAAA
TGTTAATGGTCGCTAAATCAGAGAATCGAGCGTGGAACATAGCAAAAGGCGCATGTGCTCTCACGTTTTT
ATCATGGTTAGCTTTGATCTTTCTTATGCCACTAAAAACGGTTGTGCCTTACGTCGCAATGGTGAATGAA
ACCACAGGTCATACACAATTACTGACAACCATCACCGAAGAGACCATTAGCAAACAAGATGCCCTTGATG
CTTATTGGGTGGCCTACTACGTGCGTAATCATGAAACTTATGATTGGTACACCATTCAAGACAGTTATGA
CAACACACTGTTACTTTCTAGTGACGAGGTTGGCCGTGATTATGCTGGACTCTTTGAAGGCAATAATGCC
CTTGATTCGGTATGGGGTAAACGAGTGAAAGCTCAGGTTCGTTTACTCAGTAAACCTATCATCAAGAATA
ACATTGCTACGGTACGATTTGAAAAAACCATTAAATCCGTCGATGACACAGGAAAAGGACAACCGACGGT
ATGGATAGCAACACTTGCTTATCAATACAAATCAGACCCACTAACAGAAGAAGAACGCCTTAAAAATCCA
TTAGGATTTCAGGTGGTCAGTTATCGATTAGATCCCGAACTTATGGAATAG
 Primer design