SecReT4
Protein ID: 59714397
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0041
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]29523..30431 [+]
Productchannel protein VirB9
Component typeVirB9
UniProt IDQ5DY63
KEGG IDvfi:VF_B0041
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 6.7e-61, Aligned region: 28..274
Protein Sequence: 302 a.a.     [Download]
>gi|59714397|ref|YP_207171.1| channel protein VirB9 [Vibrio fischeri ES114]
MKASIWLLSCFVFTPCFALNIPVQSPLDSNIQYSTYQANNVVEVTAYIGMASHIVFDKSEKIELVQSGFS
EGWEFIKNGNHLFIKARSVPSTETITDHLGNVTTKEIFITPSKEWETNLIVVTSKRNYTFLLTLGKGDKG
RRQNTYRLSFQYPEEKAVQDKIVADIAVEKTKLAKAKIDTHSEPEIRNWKYVQQVGKNSRNIAPYRAWDN
GRFTYLSFKKNSEIPAIFMVSETGQETLVNINIDINDPDTVIIQRIAKQFVLRLDDSVVGITNKGFNTLN
VNNDTGSTIKNVVREVKGVDTP
 
Nucleotide Sequence: 909 bp     [Download]
>gi|59714356|ref|NC_006842.1|:29523-30431 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGAAAGCCTCGATTTGGTTATTAAGCTGTTTTGTTTTTACCCCTTGTTTTGCTCTAAACATCCCCGTTC
AATCTCCCCTAGACTCCAACATTCAATACTCAACTTATCAAGCTAATAACGTGGTCGAAGTTACCGCTTA
CATCGGTATGGCTTCACATATTGTGTTTGATAAATCAGAAAAAATTGAATTGGTTCAATCTGGTTTTTCA
GAAGGATGGGAATTTATTAAAAATGGAAATCATCTTTTTATCAAAGCGCGTTCAGTGCCAAGCACTGAAA
CGATCACCGATCATTTAGGTAACGTGACCACAAAAGAGATCTTCATTACTCCGTCGAAAGAATGGGAGAC
CAACTTAATTGTGGTTACAAGTAAACGCAATTACACCTTCCTTCTTACGTTAGGAAAAGGGGATAAAGGA
CGCAGACAAAACACCTACCGTTTGTCGTTTCAGTATCCAGAAGAGAAAGCCGTTCAAGATAAGATTGTCG
CGGATATTGCCGTTGAAAAAACAAAACTGGCTAAAGCCAAAATCGATACTCACTCTGAGCCTGAGATCAG
AAACTGGAAATACGTACAACAGGTCGGCAAAAATTCCAGAAACATAGCCCCGTATCGAGCATGGGATAAT
GGTCGCTTTACCTATTTATCATTCAAAAAGAATAGCGAGATACCGGCTATTTTTATGGTATCTGAAACGG
GACAAGAAACCCTTGTCAATATCAACATTGATATTAACGATCCTGATACGGTCATCATCCAACGTATTGC
AAAACAATTTGTATTACGCCTTGATGATTCCGTTGTCGGTATCACCAACAAAGGATTCAATACGTTAAAC
GTCAACAATGATACGGGTAGCACCATTAAGAACGTGGTCAGAGAAGTAAAAGGAGTGGATACACCATGA
 Primer design