SecReT4
Protein ID: 59714398
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0042
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]30428..31618 [+]
Productchannel protein VirB10
Component typeVirB10
UniProt IDQ5DY62
KEGG IDvfi:VF_B0042
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6e-63, Aligned region: 212..387
Protein Sequence: 396 a.a.     [Download]
>gi|59714398|ref|YP_207172.1| channel protein VirB10 [Vibrio fischeri ES114]
MTIEHLEGEALSIPSTNSNQRDKKHVLLFLIICGFILSCLIWFIFFNSSDKESVSAPTQPSINTSTHKAS
TPQSNKTFEWKPSEPSQPEQKDVEDTSTETKEKIVDTPPVAPVSQPLPPNGQLNSYTPKRTVAQIDKSKS
SMSSGSQGSENGLQLTPPYPTYPSVPTTGTPSSFFNTQENDNESNNSQRITSLLNTSKTENSVAAVLYNR
DYLLAKGAYIDCVLNTSMNSTVAGMTKCTLTRDIYSDNGNTLLIERGSEVTGEYRANLSQGQARLFVLWD
RVKTPHGVIVDLASPATDSLGAGGVNGYVDTHFWERFGGAMMLSLVDDLAGYMATNGGKSINNFENSSNA
AQDMAAEALKNTINIPPTFYKNQGERIGIFIARDIDFSKVYRLKVQ
 
Nucleotide Sequence: 1191 bp     [Download]
>gi|59714356|ref|NC_006842.1|:30428-31618 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGACAATTGAGCATTTAGAAGGTGAAGCACTTTCTATCCCAAGTACAAACTCAAATCAAAGAGATAAGA
AACACGTTCTTCTCTTTTTGATTATTTGTGGTTTTATCTTAAGTTGTTTGATTTGGTTTATCTTTTTCAA
TTCTAGTGACAAAGAAAGCGTATCAGCACCAACGCAACCAAGTATCAATACATCCACTCATAAAGCGTCA
ACACCTCAATCAAATAAAACATTTGAGTGGAAACCATCTGAGCCATCACAACCTGAGCAAAAGGACGTTG
AAGATACGAGCACAGAAACAAAGGAAAAGATTGTTGATACACCGCCCGTAGCTCCTGTATCGCAACCTTT
ACCACCAAACGGCCAACTAAATAGTTATACGCCAAAACGAACCGTTGCACAGATAGACAAAAGCAAATCA
TCAATGTCTTCTGGCTCTCAAGGCTCAGAAAACGGATTGCAATTAACACCACCATACCCAACGTATCCAA
GCGTTCCGACCACTGGCACACCATCGTCATTTTTCAATACTCAAGAAAATGACAATGAAAGCAACAACAG
TCAAAGGATCACTTCGTTATTAAACACCAGTAAAACTGAAAATTCCGTTGCCGCCGTTTTATACAACCGT
GATTACTTACTGGCAAAAGGGGCGTACATAGATTGCGTTCTTAATACCAGTATGAACTCTACCGTTGCAG
GGATGACAAAATGCACCTTGACTCGTGATATTTACAGCGATAACGGTAACACCTTATTGATCGAGCGTGG
CTCAGAAGTCACAGGGGAATATCGAGCTAACCTATCACAAGGACAAGCAAGGCTGTTTGTTCTATGGGAT
AGAGTAAAAACCCCTCACGGTGTCATTGTTGATTTGGCATCACCAGCAACCGACAGTTTAGGTGCAGGAG
GCGTGAACGGTTACGTTGATACGCATTTCTGGGAGCGATTCGGTGGCGCCATGATGTTATCTCTTGTTGA
CGATCTGGCTGGATACATGGCAACGAATGGCGGAAAAAGCATTAACAACTTTGAAAACTCCTCCAATGCT
GCGCAAGATATGGCAGCAGAGGCATTAAAAAACACCATCAATATTCCACCGACGTTCTACAAAAACCAAG
GTGAGCGTATCGGCATTTTCATTGCTCGTGATATTGATTTCTCCAAGGTCTACCGCTTAAAGGTTCAATG
A
 Primer design