SecReT4
Protein ID: 59714399
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0043
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]31621..32628 [+]
ProductVirB11 ATPase
Component typeVirB11
UniProt IDQ5DY61
KEGG IDvfi:VF_B0043
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.8e-69, Aligned region: 14..314
Protein Sequence: 335 a.a.     [Download]
>gi|59714399|ref|YP_207173.1| VirB11 ATPase [Vibrio fischeri ES114]
MTIGKDTTINHLFKPLNEWLEDEDITEIAINQPNEVWIEKHDQWTSYSCNALSFDHLNSMATAVASFCDN
NISVSQPILSATLPKGERIQFVIPPACSPNTVSITIRKPNIAQRTLKDYVRDGFFNHVIPTQQTMSPIDK
QLLDLKDTDLSTFLKLAINAQKTIVIAGGTGSGKTTFMKMLVDLIPKAQRIITIEDVSELFLPNTPNKVH
LFYPSEATQSDPVTSAKLLKSCLRMKPDRILLAELRGAETFDFVNIAASGHGGSITSCHAGSVALTFERL
AAMMMKNPEAISLPYEAIVKLLHQVIDIVIHIENDVHSDNPIGRHITEVWFKPNE
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|59714356|ref|NC_006842.1|:31621-32628 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGACAATAGGCAAAGATACCACCATCAATCACTTATTTAAGCCTCTTAATGAATGGCTTGAAGATGAAG
ACATTACTGAAATTGCCATCAATCAACCAAATGAAGTGTGGATTGAAAAGCACGACCAATGGACATCTTA
TTCTTGTAACGCGCTTTCATTTGACCATCTCAATTCAATGGCGACAGCGGTCGCCTCTTTTTGTGATAAC
AATATTTCAGTCAGTCAGCCAATTTTATCAGCAACGTTACCCAAAGGAGAACGTATCCAATTTGTTATAC
CTCCAGCGTGTAGCCCGAACACGGTAAGCATCACCATACGAAAACCTAACATTGCTCAACGCACCTTAAA
AGATTATGTACGAGACGGCTTTTTCAATCATGTGATCCCTACTCAACAAACAATGTCCCCTATCGACAAA
CAATTATTGGATCTCAAAGACACAGATCTATCTACGTTTTTGAAATTAGCCATTAATGCTCAAAAAACCA
TTGTGATTGCAGGAGGGACAGGCTCAGGTAAAACCACATTTATGAAGATGTTAGTTGACTTAATTCCCAA
AGCTCAACGCATTATTACCATTGAAGATGTGTCTGAATTGTTTCTACCAAATACACCCAATAAGGTGCAT
TTGTTTTACCCAAGTGAAGCAACACAAAGCGATCCTGTCACTTCAGCAAAACTACTTAAAAGCTGTTTAC
GCATGAAACCCGATCGCATTTTATTAGCAGAACTTCGAGGCGCAGAAACCTTTGATTTTGTGAATATCGC
AGCATCAGGTCATGGCGGAAGCATCACCAGTTGCCACGCAGGAAGCGTGGCACTGACCTTTGAGCGATTA
GCCGCCATGATGATGAAAAACCCCGAAGCCATCTCCTTGCCTTATGAAGCCATCGTAAAATTACTTCATC
AAGTCATTGATATTGTCATCCATATAGAAAATGACGTTCATTCGGATAATCCAATAGGTCGTCATATAAC
AGAAGTGTGGTTTAAACCAAATGAATAA
 Primer design