SecReT4
Protein ID: 59714400
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0044
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]32705..34531 [+]
Productprotein VirD4
Component typeVirD4
UniProt IDQ5DY60
KEGG IDvfi:VF_B0044
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.7e-110, Aligned region: 66..523
TraG-D_C [PF12696], Evalue: 7.6e-27, Aligned region: 367..483
TrwB_AAD_bind [PF10412], Evalue: 5e-21, Aligned region: 280..487
Protein Sequence: 608 a.a.     [Download]
>gi|59714400|ref|YP_207174.1| protein VirD4 [Vibrio fischeri ES114]
MIHSANTEIVTPYTIIEQWIYYSEDMRYQKSLVTALLIGFGIAVIAPTLLFLFNTKEKEELHGSARFATQ
DEIKKEGLTNNNGKGILIGQFNGFLGFFKTYLYFNSDSFILLIAPTRSGKGVGVVIPNLLVYNQSMVILD
LKQENFSITSKYRAKYGQQVFLFNPFTENGQTHRYNPLSYVREGDCKIGDILTITASFYPIDDLKNSFWN
NQASNLFLGLALMISETPSLPFTIGELLRQSSGKGKPLKEYLQGIMDDREKSSSPLSESCIDALNRFIAL
TDNSLSNVLASFNAPLTLWANPLFDAATSANDFDLRELRKKKMTVYIGITPDYLEQAERILNLFFSQLIN
INTKELPEHNPELKYQCLLVMDEFTAMGRIGILAKSVSYMAGYGLRLLTIIQAPSQLDSVYGKEEARTYK
TNHAGQILFAPRENEDAEEYSKAIGYKTVKAKSNSKTRGELKQTDSTSDQRRAVMLPQEIKEIGMWKEII
CIENLKPIFCKKVQYFNDPVFIDRLKEVSSSLKSIEGIPTRDQLKNAITNKELQIEIPTLERIDSKPTPT
LFDSPLNQPLPLSDHDIATVQEEVETEEQYDESLLATTYDDSDLPDFL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|59714356|ref|NC_006842.1|:32705-34531 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGATCCATAGTGCAAATACAGAAATCGTCACGCCCTATACCATCATAGAGCAATGGATATATTACTCTG
AGGACATGCGCTATCAAAAATCGCTTGTCACCGCATTACTGATTGGTTTTGGTATTGCCGTTATCGCTCC
TACCCTCCTTTTCCTTTTTAATACCAAAGAAAAAGAAGAACTTCACGGCTCGGCTCGTTTTGCAACGCAA
GACGAGATCAAAAAAGAAGGCTTAACAAACAATAACGGTAAAGGGATCTTAATCGGTCAATTTAATGGGT
TCCTTGGTTTTTTTAAAACCTATCTTTATTTTAATAGTGACAGTTTCATACTATTAATCGCTCCCACACG
AAGCGGTAAAGGGGTTGGCGTCGTTATTCCTAATTTACTGGTTTATAACCAATCAATGGTTATATTGGAC
TTAAAACAAGAAAACTTTTCTATCACCTCAAAATATCGCGCTAAGTATGGCCAACAAGTCTTTTTGTTTA
ATCCATTTACAGAAAATGGACAAACACACAGATACAACCCGTTGAGTTACGTTCGTGAAGGTGATTGCAA
AATTGGTGATATTCTCACTATCACTGCTTCTTTTTATCCAATCGATGATCTAAAAAATAGCTTTTGGAAT
AATCAAGCCAGTAACTTATTTTTAGGGTTAGCCTTAATGATCTCTGAAACCCCGTCATTACCATTCACCA
TCGGTGAACTACTAAGGCAATCGTCTGGAAAAGGAAAACCATTAAAAGAATATTTACAAGGCATAATGGA
TGACAGGGAGAAATCTTCATCCCCTCTTTCTGAATCTTGTATCGATGCACTAAACCGCTTCATCGCGTTA
ACCGACAACAGTTTATCTAACGTACTGGCCTCATTTAATGCCCCATTAACACTGTGGGCGAATCCATTAT
TTGATGCTGCGACCAGTGCCAATGATTTTGATTTACGCGAGCTAAGAAAGAAAAAGATGACGGTTTATAT
TGGTATTACACCTGATTACTTAGAACAAGCTGAGCGCATATTAAATCTGTTCTTTAGCCAATTAATTAAT
ATCAATACCAAAGAGCTGCCAGAGCACAACCCTGAGCTGAAATATCAATGCTTATTGGTTATGGATGAAT
TTACCGCAATGGGAAGGATAGGCATTCTTGCAAAATCCGTATCTTACATGGCTGGTTATGGCCTTCGTTT
ATTAACCATTATTCAAGCACCGTCTCAACTAGACAGTGTATATGGCAAAGAAGAAGCCAGAACCTATAAA
ACAAACCATGCAGGACAAATCCTATTTGCACCCCGTGAAAATGAAGATGCTGAGGAGTATTCAAAAGCCA
TCGGTTACAAAACCGTAAAGGCAAAAAGTAACTCTAAGACCAGGGGAGAACTGAAACAAACGGATTCGAC
ATCAGATCAACGTAGAGCCGTTATGTTACCCCAAGAAATCAAAGAGATAGGGATGTGGAAAGAAATCATT
TGTATTGAAAATCTTAAGCCAATTTTTTGTAAAAAAGTTCAGTATTTTAATGATCCCGTCTTTATCGATA
GGTTAAAAGAAGTCTCTTCATCCCTCAAATCGATAGAAGGAATACCCACACGAGATCAGTTAAAAAACGC
GATCACAAATAAAGAGCTTCAAATTGAAATACCAACACTAGAGCGGATTGACTCTAAGCCAACTCCGACA
TTATTTGACTCACCATTAAATCAACCACTGCCGTTATCAGATCATGATATTGCCACTGTTCAAGAAGAAG
TCGAAACAGAAGAACAATATGATGAATCTCTTTTAGCGACAACATACGATGATTCTGACCTCCCTGATTT
TCTCTAA
 Primer design