SecReT4
Protein ID: 59714410
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0054
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]44060..44800 [+]
Productattachment mediating protein VirB5-like protein
Component typeVirB5
UniProt IDQ5DY50
KEGG IDvfi:VF_B0054
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.2e-60, Aligned region: 39..226
Protein Sequence: 246 a.a.     [Download]
>gi|59714410|ref|YP_207184.1| attachment mediating protein VirB5-like protein [Vibrio fischeri ES114]
MQIKTTIKAIALGLSLTIPSVHAGFPVSVLVDVPGQLAQFQNMAQMLKEYATMLDQLNKMQEQLQQMERE
YNSVTGTRGLGNILNNPDFSKHLPDNWQTILRNIRYNGYEGLDGAAKALRDASKVIDSCEYIEDRVERQN
CAALALKPVQDQAFATNAYQKSYDRTAQIESLMNEINRTRDPKAIAELSARIQAEQALIQNEQTKLSMYQ
ATSESEQRLLLQQQKEINSRTWRSKNYGADVPPMEF
 
Nucleotide Sequence: 741 bp     [Download]
>gi|59714356|ref|NC_006842.1|:44060-44800 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGCAAATAAAAACAACCATCAAGGCCATCGCCTTGGGGCTTTCGCTCACCATCCCTTCTGTACACGCTG
GATTTCCTGTTTCTGTATTAGTTGATGTTCCTGGTCAATTAGCACAATTTCAAAATATGGCTCAAATGCT
TAAGGAATACGCCACGATGCTAGACCAGCTCAACAAGATGCAAGAGCAATTACAGCAAATGGAACGGGAA
TATAATTCCGTGACAGGGACACGGGGACTTGGGAACATTTTAAACAATCCTGATTTTTCAAAACACTTAC
CTGATAACTGGCAAACCATCTTAAGAAATATTCGTTATAACGGGTATGAGGGATTAGATGGTGCAGCAAA
AGCATTGCGTGACGCGAGTAAAGTCATTGATTCTTGTGAGTACATTGAAGATCGAGTGGAACGTCAAAAC
TGCGCCGCCCTTGCACTGAAACCAGTGCAAGACCAAGCATTTGCAACAAATGCTTATCAAAAATCGTATG
ATCGCACCGCTCAAATTGAATCATTAATGAATGAAATCAACAGAACGCGAGATCCAAAAGCCATCGCTGA
ATTAAGCGCACGTATTCAAGCTGAGCAAGCACTTATCCAAAACGAACAAACCAAACTTTCCATGTATCAG
GCAACCAGTGAATCAGAGCAACGTTTGTTGCTTCAACAACAAAAAGAAATTAACTCAAGAACATGGCGAA
GCAAAAACTATGGTGCAGATGTACCACCAATGGAGTTTTAA
 Primer design