SecReT4
Protein ID: 59714411
T4SS name [ID]VirB [213]
Gene symbol-
Locus tagVF_B0055
StrainVibrio fischeri ES114
Repliconplasmid pES100 [GenBank: NC_006842] [Browse all T4SS(s) in this replicon]
Location [Strand]44803..45837 [+]
Productchannel protein VirB6
Component typeVirB6
UniProt IDQ5DY49
KEGG IDvfi:VF_B0055
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-43, Aligned region: 40..263
Protein Sequence: 344 a.a.     [Download]
>gi|59714411|ref|YP_207185.1| channel protein VirB6 [Vibrio fischeri ES114]
MKITVFNFIGTTIDDLTNNFIASGIGGLIDILQPFIIAGVTLYIMIRAYGQIFGKGEDLAIDLVIHGLTV
IAVTTLVLNIHNYTYYVVEGLNAFASGVSGAINKTDGNIYNTLDELLESGIAQASYCFDKVGLLNDWGWG
FAGIVIAGAIVTITLLSAVLIIGTKFLLTMLFVIGPLFIVFAIYPVTRRYFEGWVTKLMENALVQIFGVM
IIGLSLSIISHFIYYKDASSTGVNPLGVSIQILIVSGILSWIIAQIPNLAGSLAGGFSSSSLSLAAAVAP
MLAATAIGAKFLNGKNIPTGGISSETWGEQQSNQLRQGDSTSTPQATKMAQSVHDKIAEHNRNN
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|59714356|ref|NC_006842.1|:44803-45837 Vibrio fischeri ES114 plasmid pES100, complete sequence
ATGAAAATTACCGTATTCAATTTTATTGGAACAACAATCGACGATCTAACAAACAACTTTATTGCATCAG
GTATTGGGGGGTTAATTGATATATTACAACCCTTTATCATTGCAGGAGTCACCTTGTACATTATGATCAG
AGCTTACGGCCAGATATTTGGTAAAGGTGAAGATCTCGCTATTGATTTAGTGATTCATGGCCTAACCGTG
ATTGCCGTTACAACCTTGGTCTTAAATATTCACAATTACACTTATTATGTCGTCGAAGGACTCAATGCAT
TTGCAAGTGGTGTATCAGGAGCCATCAATAAAACCGATGGAAATATCTATAATACCTTAGATGAACTTCT
TGAAAGTGGCATTGCTCAAGCCTCTTATTGTTTTGATAAAGTCGGATTGCTTAATGATTGGGGATGGGGA
TTTGCAGGAATAGTGATTGCAGGAGCTATCGTTACCATTACTTTGCTATCAGCTGTCCTAATTATTGGTA
CTAAATTTCTTCTTACTATGTTATTCGTTATCGGACCCCTTTTTATTGTCTTTGCGATTTACCCTGTCAC
CCGTCGATATTTTGAGGGATGGGTAACTAAGTTAATGGAAAACGCCTTGGTTCAAATCTTTGGGGTAATG
ATCATTGGTCTATCACTCAGTATTATTAGTCATTTTATCTATTACAAAGATGCCAGTAGTACAGGAGTAA
ATCCACTTGGCGTATCAATTCAAATTTTAATTGTGAGTGGCATTTTAAGTTGGATCATAGCTCAAATTCC
TAATTTAGCTGGCTCACTGGCTGGTGGATTCTCATCAAGCTCTTTATCGTTAGCTGCTGCCGTTGCTCCT
ATGCTTGCGGCAACTGCAATAGGAGCAAAATTTTTAAACGGTAAAAATATACCAACTGGCGGCATATCTT
CTGAAACATGGGGAGAGCAACAATCGAACCAACTACGACAAGGTGATTCAACGTCAACACCACAAGCCAC
CAAAATGGCTCAATCCGTTCACGATAAAATTGCAGAGCACAACCGAAACAATTAG
 Primer design